CAZyme Information: MGYG000001988_01779

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_01779
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	MGYG000001988_15|CGC1	55562.59	4.6341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 53360; End: 54871 Strand: +

Full Sequence      

MTRFMELKTDSLDIIRSVDERLMSYNIEMAEVTGGTFWKAYTKEQIAGTEEFALASMPTQ
SFTDMAELMQYYPPIDLSNVRLIELAKQFGPVWIRVSGSWATKTYYDFEGVTEGVVPEGY
QNILTREQWIGVLEFVKAVDGKLLISVSNCAGDHPNGGPLDLAQARKIFAFSHEYGVDID
AAEFMNEPNMLQLSGTPAGYTASDYARDQDIFNRWVRENYPHCLIVGPCTTGDPSVVKPG
EKNISAGIGSLMDVCTTHDLMEGTKVSLDVFSYHYYNGISERLSSAAPDSHWDSKEAHTD
AYLDVAPCCVKNHIPLRDQYVPGGQMWVTESGDAGGGGDTWASTYLDVFRTLNELGSFSE
LTDGVVFHNTLASSDYGFLQHGTFEPRPNYFAVLLWNRLMGSTVYDCGNPGIENAHIYCH
SRKDKKPGVSYLIINNSLTDDLTVRIPKEADRYTLSGETVRSAVMRLNGRELTISGMAGL
PDLSPVKQAAGAVRLIPGTVLSL

Enzyme Prediction     

No EC number prediction in MGYG000001988_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	50	491	6.8e-66	0.9582417582417583

CDD Domains     

MGYG000001988_01779 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	3.47e-225	1	499	1	503
AXI08463.1	8.52e-220	1	499	1	498
QGS68324.1	8.52e-220	1	499	1	498
SNU86930.1	1.53e-206	1	500	1	502
QTH47273.1	1.54e-192	1	497	1	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RG8_A	7.69e-09	158	497	41	369	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5E8M_A	9.47e-07	183	483	67	357	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5LA4_A	1.17e-06	183	483	187	477	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
5L9Z_A	2.21e-06	183	483	67	357	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FF10	6.76e-27	75	492	75	520	Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
Q9LRC8	8.62e-20	75	488	73	494	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
Q8L608	5.07e-19	75	487	72	511	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
X4Y2L4	2.20e-13	75	484	40	459	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
Q90YK5	3.45e-09	260	497	263	505	Heparanase OS=Gallus gallus OX=9031 GN=HPSE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_01779.