CAZyme Information: MGYG000001981_00648

Basic Information

• Species: CAG-617 sp000431275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000431275
• CAZyme ID: MGYG000001981_00648
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000001981_11|CGC1	34740.62	10.0976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001981	2121938	MAG	Spain	Europe

• Gene Location: Start: 11093; End: 12010 Strand: +

Full Sequence      

MKTISLIKPHFILLTFLLSLSQWTNAQRSPYEAYIDTYKGLAVEQMERYGIPASITLAQG
LLESAAGQSELSRKANNHFGIKCGGSWNGPYVLRDDDARNEKFRAYSSPRESYEDHSVFL
ATRSRYAFLFKYKKSDYKAWAHGLKKAGYATNPRYAHLLIKLIHRYDLDRYDKMTVSDFP
SLPGALGEVADGLIVRRNNDNYYVIARGGDTFASIGREMGVSERKLRKYNEVDKHYRLQA
GDIVYLEKKRSKADKAFKGKYHTVRPGESLYTIAQKYGIPLKTLYKNNDLTAGDAAFVGG
RLKIR

Enzyme Prediction     

No EC number prediction in MGYG000001981_00648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	42	168	2.2e-35	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.43e-38	3	173	8	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.56e-36	32	172	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.92e-27	31	172	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.14e-26	41	116	3	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.26e-23	43	163	152	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83099.1	2.22e-100	8	305	2	303
QVJ81211.1	2.22e-100	8	305	2	303
QJR97929.1	2.47e-99	10	304	6	301
QJR67483.1	6.17e-99	11	305	8	298
QJR58959.1	6.17e-99	11	305	8	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	2.14e-15	32	164	2	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.60e-15	32	164	3	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.79e-14	32	164	3	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	2.97e-10	32	172	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	4.11e-10	51	220	80	273	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.14e-20	32	177	49	203	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	4.40e-12	18	162	147	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9CIT4	3.53e-10	21	232	52	271	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
Q9KQ15	1.13e-09	25	167	155	307	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	1.85e-09	51	220	340	533	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999080	0.000194	0.000151	0.000143	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001981_00648.