CAZyme Information: MGYG000001981_00613

Basic Information

• Species: CAG-617 sp000431275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000431275
• CAZyme ID: MGYG000001981_00613
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		39622.55	9.1407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001981	2121938	MAG	Spain	Europe

• Gene Location: Start: 19881; End: 20927 Strand: +

Full Sequence      

MIQKVLVIRFRRVGDSVLATALCRSLKESFPGVEVHFVLNAGIAPLYAGHPDIDKVIAFT
DEEQHGMTYLRKVWQTVRATRYDAIIDMRSTPKTLPFSLFSPGTPYRIGRRKPYNVGVHN
YRLENPSGVDRVQTNLNLMTPLAREGRLVMNPHFRLVISEDERRAFRSYMSREGVDFGRP
VVLCAVTARLEYKVWPYERMARVLRRLLDSYDAQLVFNYAGDVEAAAARALRDRLGGDSR
VMLGVQAQGLRELCAMTVNSDLFFGNEGGPRHIAQALGVPTLALFPPGVEKWFWLPGADE
RQRGLSPDDYLDPERQQAMTYAQRFDLIPEDDVWAQLADMMNRYVVKP

Enzyme Prediction     

No EC number prediction in MGYG000001981_00613.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	308	4.1e-33	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.51e-45	4	337	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.10e-44	2	302	1	293	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK10422	PRK10422	3.97e-15	3	341	6	343	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	3.62e-11	71	287	2	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	0.002	4	111	2	109	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK54674.1	4.45e-117	4	345	3	348
AVV52897.1	8.51e-117	4	345	11	353
AOH41188.1	8.51e-117	4	345	11	353
QIK60100.1	4.76e-114	4	345	3	348
BAR51520.1	1.13e-113	2	347	7	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.04e-06	3	287	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	6.34e-12	14	335	5	325	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.24e-09	14	341	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001981_00613.