CAZyme Information: MGYG000001972_02095

Basic Information

• Species: Prevotella sp900315955
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900315955
• CAZyme ID: MGYG000001972_02095
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		45342.82	4.9373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001972	3441323	MAG	Denmark	Europe

• Gene Location: Start: 7651; End: 8847 Strand: -

Full Sequence      

MKYKKILFIIAFSAFTLASCSDVDKIEPEPNNIAIPSADVKTLSLSDPQATAETKALYSN
LWAIEQKGFMFGHHDDLMYGRYWYGDDGGSDTKAVCGDYPAVYSVDLAEVMDDRSLTAKS
QSANEIRKRCITEARHRGEVIIACMHLNNPLTGGDSWDNSNKDVVAQILTQGSATNQKFN
TWLDRLVVFVNSLKDDKGNPIPMIFRPFHEHTQSWSWWGSSCTTEQQFIDLWRYTVNYLR
NAGIHQFIYAIAPQMDTPKTENDFLYRWPGDDYVDFIGMDAYQGLTPEVFSRNMRTLASV
AAKKQKPCGVTETGVEGFTDKKYWTEQILTPAENRHVSMIVTWRNKFVDGNESDKHYYSV
YPGHPSADDFIRFYNDPTTFFSSDLPDMYTMADGMEVN

Enzyme Prediction     

No EC number prediction in MGYG000001972_02095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	46	361	8.1e-61	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.41e-31	47	282	2	230	Glycosyl hydrolase family 26.
COG4124	ManB2	3.82e-14	146	377	128	342	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88729.1	1.60e-193	4	398	2	390
ALJ60278.1	1.31e-192	4	397	2	389
QGT72560.1	3.14e-168	4	397	3	393
QRM99613.1	3.14e-168	4	397	3	393
CBK67266.1	3.14e-168	4	397	3	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.87e-85	49	391	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	4.62e-70	44	389	32	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.62e-70	44	389	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	8.58e-70	44	389	55	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.60e-69	44	389	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.07e-47	31	389	33	415	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.87e-31	42	373	39	386	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
G2Q4H7	8.60e-13	44	352	173	454	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.69e-10	45	324	146	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	1.40e-09	93	282	80	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000082	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001972_02095.