CAZyme Information: MGYG000001972_01680

Basic Information

• Species: Prevotella sp900315955
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900315955
• CAZyme ID: MGYG000001972_01680
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	MGYG000001972_77|CGC1	48899.02	8.0712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001972	3441323	MAG	Denmark	Europe

• Gene Location: Start: 9130; End: 10437 Strand: -

Full Sequence      

MNILRQPTGIHKLVCGLFMFLFSTTASAQKYVGGDISMLPAYEKAGATYYTHDGEPINDL
ITYSKEEGWNAMRVRLFVNPTKQTTNSSAPYTWSSDDNVCQDIEWVKSLGKRIKDAGMKF
MLDIHYSDTWADPGKQWTPAAWASLSDEALATKVYDYTQDVLTQLKTAGATPDFVQTGNE
ISYGMLWGQPNGTLKQCWPSSPAANWTRFEKLLGQATKAVRTTTPSAKIILHVERVSTSQ
QNDNTGYKALTNFYNQMTAANIDYDIIGLSYYPYFHGALSELEGAINKLEGFHPTKSIMV
VETGYPYEWAVSGTPVDYKKPYEYSDDGQKKYTEDLITMLNKHRNVNGLFWWWPEYNAKG
TTLSGWYNAPLFDSNTGKATSALSSLKNFRNESTGIKAVQSKATKDDNYYNLAGQRVCAP
RQGVYIKDGKKQLIR

Enzyme Prediction     

No EC number prediction in MGYG000001972_01680.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	32	383	1.1e-87	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	7.34e-86	31	384	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	3.69e-68	19	395	27	397	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14955.1	1.45e-150	25	389	42	397
ADE83762.1	1.90e-150	12	435	5	416
QVJ80245.1	2.60e-129	12	435	5	423
QUT66820.1	4.76e-91	29	389	23	363
AGB28452.1	4.11e-88	26	398	18	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.85e-45	33	390	53	392	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	2.08e-37	28	384	1	327	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	2.84e-35	28	384	1	327	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	3.88e-35	33	360	27	328	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
4BF7_A	1.57e-34	21	356	11	317	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	9.61e-49	32	373	8	334	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	3.68e-38	17	384	10	351	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
P48841	5.57e-38	31	373	28	351	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
O07013	1.50e-37	33	360	56	357	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q4WJ80	2.64e-37	17	384	11	351	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.998984	0.000228	0.000165	0.000153	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001972_01680.