CAZyme Information: MGYG000001963_02525

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_02525
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		59033.57	7.4845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 9764; End: 11347 Strand: +

Full Sequence      

MRNFKKTLLGAVAVCALLCAPLSMTAQSLSPSTKWHWDKGTIVVETPERPAGQESALGMT
LPKMNVVRVGFVGLGMRGPGAVERFTHIPGVKIAALCDYEADRAERCQGYLRKASLPKAD
IYSGEEGYKALCERNDIDLVYIATDWLHHFPVAKYAMEHGKNVAIEVPSVMNLEQCWELI
NLSETKRLHCMILENCCYDWFEMNTLNMAQHGVFGEVIRAQGAYIHNLDQFWNAYWKGEG
KSNKLGWRLEYNMKNRGDVYATHGLGPVAQALDIHRGDRMRTLIAMDTKSFNGKAEVEKV
TGKECNEFRNGDHTTTLIRTENGKVIEIQHDVLTPQPYNRLYQLTGTKGFANKYPIEGYA
IDSKQMAASGVQPKVDNLNTHSFLPKAEKDALVAKYQHPILKKYGEMAKEVGGHGGMDFI
MDSRLVYCLQNGLPLDMDVYDMAEWCALAELGALSMDNNYASVAFPDFTRGHWNDVKGYK
HAFASAEDEAEAERIAKEATAKMKEEGAKQWAKIAKQEAKAAKKNKK

Enzyme Prediction     

No EC number prediction in MGYG000001963_02525.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	474	9e-156	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.19e-18	64	359	1	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.04e-09	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	3.35e-08	67	217	5	145	putative oxidoreductase; Provisional
PRK10206	PRK10206	5.30e-05	135	218	63	146	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ31109.1	1.75e-311	6	503	7	503
QRO24012.1	2.96e-302	1	503	1	503
ALJ59362.1	3.37e-297	1	503	1	500
QUT89581.1	3.37e-297	1	503	1	500
ALA73874.1	1.53e-296	1	503	1	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.22e-81	49	473	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	6.82e-64	67	488	21	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	2.38e-08	65	217	6	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3EVN_A	1.11e-06	64	218	3	149	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3F4L_A	4.88e-06	136	224	65	153	Crystalstructure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_B Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_C Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_D Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_E Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_F Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	3.56e-296	1	503	1	503	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	6.19e-289	1	503	1	502	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	5.17e-251	3	500	2	494	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q5LGZ0	1.76e-204	16	484	13	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	1.76e-204	16	484	13	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000972	0.647474	0.350590	0.000438	0.000281	0.000223

TMHMM  Annotations     

start	end
7	29