CAZyme Information: MGYG000001952_01379

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_A
• CAZyme ID: MGYG000001952_01379
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	MGYG000001952_79|CGC1	75103.09	5.6191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001952	2903653	MAG	Denmark	Europe

• Gene Location: Start: 8162; End: 10144 Strand: -

Full Sequence      

MKWWMDHKFRMVQNNLRDIDGSMDVDLEISMLKKFHANVVQVGCGGISAFSDTGLDCQKK
TPFLQGDKFGELVEKCHAENIRVIARFDVSKVHQSFEASHPEWLQRTGTGEAVHYNDTVL
TCVNGPYQQEKTLEIIGEILNKYPVDGIFFNMFGYQTHDYSGNYVGICQCENCRKRFREL
FGEELPDREDESSPVFQKYQEFKKITVDQLLRKIQEGVKRISPDIALSTYFDQGVDIIRC
ESNTAVDRPLPLWIYSASDNVSSIEGTFADKVSSNCAINAVDIPYRFMGVSDTFNRIRMY
ENMANGGNLDWCIIGSFEDYPDRSNYKGVETVFSFHEQYQDIFDCLHSAARVLLIRPGAP
YLPGNYEEYRGIFRMLKEAHIPFDTLIDLDTEQYRNHPANYDLIIVPGIARLKSEKLRAA
LLKTRASVIATGGSFAEDRELLERYFGIAKLTRHQCVRGAYYKTVPKTVFHSFADQDWVY
QDRSFWTAEPADGSSDSQPILPYISPAVFGPPERCYGHRTTDIPGAVIGSWGISILWEVG
TLYYTQGYEAFKQIFLDLMDQIRGGISALMPFVTDAHESMEMFYGHGGDHTDLIQLINLS
GFSGVTVGRPVPQKNIRITLKKTPVKVEELTPEGIKEVAHKGNSFSVEECGLYKAYRIQY

Enzyme Prediction     

No EC number prediction in MGYG000001952_01379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	30	152	8e-19	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	1.46e-27	32	152	9	135	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
pfam02638	GHL10	4.22e-06	67	228	70	226	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.
cd03143	A4_beta-galactosidase_middle_domain	6.75e-04	346	438	4	93	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
COG1649	YddW	0.002	67	228	115	269	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
cd01653	GATase1	0.005	352	433	1	84	Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35953.1	7.07e-175	1	626	1	629
QOT11970.1	2.67e-162	1	620	3	625
AXE16781.1	1.09e-117	1	621	33	665
QNL51905.1	1.25e-115	3	630	30	673
QEL02902.1	3.38e-115	3	630	37	679

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001952_01379.