CAZyme Information: MGYG000001951_01390

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_01390
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	MGYG000001951_13|CGC1	62936.69	6.2357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 14928; End: 16655 Strand: +

Full Sequence      

MIRRFLTALLLVLPCAVMSAGTHDELVREYITPARIIPLADSLAAGAANAGALLRPFDGQ
LAVASPDVCVLSTHQGRRAAVLLDFGRELCGAVELAAPLRGSQKALKVRICLGESVSEAL
SDVSAPGATATNEHSLRDFTVALPWLGTVELGNSGYRFAYVELVEPDAELPLRAVRGVAR
YRDLPYLGSFKSSDPRLNDIWATGAYTVHLNMQNYLWDGVKRDRLVWVGDMHPEVMTIAN
VFGNYDVVRKSLDFARDTSPLPGWMNGIAAYSMWWIIIHRDLCLYSGDTDYLAAQTDYLK
RLIDCFDAGLDGNKENYREGQRLLDWPTSEMPEVIHSGYQSLLSIAMEAAAQIGEWTGDK
DLKSKSKALLSKVRSHVPPTGGAKQSAALAILADMSRNQQTDRNIILDGEARGFSTFYGY
YMLEALASAGAYADAMSIMSQYWGRMLDLGATTFWEDLDYADAMKAARIDEPVPAGAFDI
HKSSGAYCYRGHRHSFCHGWASGPTPWLSRHVLGVRPAAPGFSEVVIDPHLGTLEAVEGT
VPTPRGIISVKHRRRADGSVESEIQVPEGVKIVSK

Enzyme Prediction     

No EC number prediction in MGYG000001951_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	78	571	2.4e-96	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.11e-19	188	512	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.01e-08	514	571	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL00915.1	3.42e-263	24	573	35	586
SCM59046.1	2.21e-225	22	573	34	587
CEA16344.1	3.63e-216	24	570	41	590
BBD46130.1	9.67e-212	24	573	36	587
BBL11632.1	1.46e-211	143	573	1	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.38e-44	51	550	166	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.20e-11	80	513	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003785	0.994339	0.001101	0.000312	0.000220	0.000215

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_01390.