CAZyme Information: MGYG000001925_00031

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_00031
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000001925_1|CGC1	91545.31	7.1907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 28865; End: 31240 Strand: -

Full Sequence      

MFTEDMEQVTSLRPQTTSADRAIVRIVQLDKADKRLRQELSQAGVPISDLNGKWDSFFLT
VKKEQQQLLVVGSDARGTAYGVLELSRLAGISPWVWWSDVTPEKKERLTVDEDFQTLQSP
SVKYRGIFLNDEDWSLQPWSWKTFEPNSIKGRIGAKTYKEIFKLLLRLRANMIWPGMHGI
TTPFYYVPKAKETADSCGIVIGTSHCEPLMRNNVGEWDTRRRGSYNYITNKDSVQAYWIE
RLKEAHPYENIYTIGMRGIHDGSMEGVQTMEEKTQALQQVIDDQRRLLAQYVNKDVTRIP
QSFVPYKEVLQIMENGLQVPDDVTLMWCDDNYGYMTRLSDAEQQKRSGGAGVYYHLSYWG
RPHDYMWLCTTQPGLIYNEMKQAYDHHARRIWIVNVHDLKPAAYDLELFLDLAWNIDCVT
PATINNHLGKWLIREFGIEAGQKLLPAMLEYYRLCAIRKPEFMGWTQVELDKKQYPRGRS
QVIDTEFSLTAFGGELDRYLESFEAVKQKIEEVEPLIDPKRKDAFYSHIKYQVFAASAMS
VKMLEAQRARSYAMGQCDETLWERENAMLRACANSQKAYQEIRMLTDYYNNRLANGKWRH
SMCYNPRDLYVFFPPTLPVGLTDKEVEMYADKTSRPVGKHPVRIDKCIARNACDYTEATN
EVFTIQALGHSMNAVSLPKGGSLTFEFDCPWEGEAVLRTAVIPTQPNDKGDIRFSVRIDN
ETPQEISFRETGRTNTWKRNVLRGQAVKKTQHTLTSGKHTLTITALDNHVVVDQWMLDFI
PERKFYVFPVK

Enzyme Prediction     

No EC number prediction in MGYG000001925_00031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	2	775	1.2e-219	0.9540889526542324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	118	462	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.10e-13	645	779	6	160	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd02795	CBM6-CBM35-CBM36_like	7.10e-05	656	780	10	122	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39773.1	0.0	1	789	50	840
AII65956.1	0.0	1	791	69	857
QJR53583.1	0.0	1	791	69	857
QJR61620.1	0.0	1	791	69	857
QJR70031.1	0.0	1	791	69	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	4.92e-206	40	774	79	770	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	2.47e-91	5	600	45	608	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	2.81e-89	4	788	74	845	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.25e-79	25	779	67	821	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	6.10e-79	25	779	66	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001925_00031.