CAZyme Information: MGYG000001921_00191

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia
• CAZyme ID: MGYG000001921_00191
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64545.18	10.0158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001921	2759672	MAG	Denmark	Europe

• Gene Location: Start: 187425; End: 189146 Strand: -

Full Sequence      

MGKRRPPACPRGGNEEIAKDGLFSFFGDLFAVTTLPHLPSIFGIPVLITGSIILLFLLAE
YIPGRFMPATLRPSSLAANLFRRMKKRLHLRSDFTLCLLLLLAAVLLIRLISMGAYPLMD
TTEARYAEMSRKMLETNHWLVPQFDYGIPFWGKPPLSFWASAVTMKLGGVNEWSARLAPF
LASLSMGLLFFAWPFRSQSGQKAAACFLVLAASGIGFVASGAVMTDEFLALGIMLSMVSF
WKAVAQPSKQPWWKYLFFVGLAVGLMSKGPLALVLTGFPVTLWTVWNREWENVWNRLPWI
KGALLMLALSLPWYLLAEMETPGFLHYFIVGEHFQRFTVKGWQGDLYGSGHASPLGTIWL
YGLTMFLPWSLLLPLLRMKKTSPLSEKATLPGENSFLWLWALSPLLFFTLARNILPAYVL
PGIPAWCILTVQGLWQWDSRHPGIKHLIFLPASIFGIMAIFLLGHGFDQLEYRCQKQLLQ
AWDGKSPLYYWDSVRPPYSAQFYSSGKVQRLEPGMLPPDNGTTYLAMKRTDYHQHRSLLS
GWKREAEERLWLLLSLPAGPGSGKHAPIPPSEN

Enzyme Prediction     

No EC number prediction in MGYG000001921_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	95	466	2.3e-93	0.6592592592592592

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.38e-41	113	429	25	331	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.70e-24	123	421	33	320	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	1.28e-19	120	328	29	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.45e-10	153	313	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	0.001	153	341	90	275	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO83743.1	0.0	2	573	192	763
QIA34994.1	0.0	2	573	192	763
QAA35483.1	0.0	2	573	230	801
QHV60546.1	0.0	2	573	192	763
QHV54806.1	0.0	2	573	230	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.23e-34	100	459	36	389	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FRR0	1.04e-29	106	460	17	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	8.83e-29	110	445	19	334	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
C5BDQ8	1.59e-28	123	462	32	363	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q48HY9	3.78e-26	100	460	10	361	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=arnT PE=3 SV=1
A4WAM1	5.77e-26	99	445	8	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999881	0.000132	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
40	62
94	116
173	195
207	241
256	278
298	317
354	376
396	415
448	467