CAZyme Information: MGYG000001913_00318

Basic Information

• Species: UMGS731 sp900544985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS731; UMGS731 sp900544985
• CAZyme ID: MGYG000001913_00318
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708	MGYG000001913_4|CGC1	78766.88	5.2234

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001913	2038964	MAG	Denmark	Europe

• Gene Location: Start: 1596; End: 3722 Strand: -

Full Sequence      

MRTSPVTEEKISDIISGMTLEEKILQMLQISDMKEKPGVFERFVKLGAGSFLHVLSAQTD
EVRAAAEKTRMKIPPIFGIDAIHGHSLLNGATIYPSQLSMSCSWNEKLVEEMGQNTAKEV
NADGIDWVFSPVLCLGRDTRWGRIDETFGEDPYLVGKLGAAIVRGYEKDGLVISCLKHYI
GYGEATGGKDSYDTELTVRKIRETFLPPFKECVDAGAGSVMTAYGSIDGTSMTKHRELLR
DILKDELGFSGFVVTDWMNIWQMRTKQKSAESFDESVRLAIESGNDMSMNCFEFYESAVR
QVKEGKIKEEYIDDAVRRILRAKFHLGLFNKDKKRMPKSVIGCKEHIETNHALTRESLVL
LKNNGILPLKNAPKKIAVIGPNADDIAAQYGDWTFTSHRPKEEYAVIKNDYYTTLRGIKE
IFGDSETVYEKGCSIRGDKDDEESIARAEKAAKEADIIILVPGDDITLNGESKDRAVLEL
SGKQNELAKRLKETGKPIITVLVNGKPLCIGELAENSDALIEMFNGGDLGGLCAAELIAG
KFNPSGKLSISFPRASGALPCYYNSYPGWHSSKYCDVDEGNLFDFGFGLSYTKFEYSDLK
ISKKEIHKDEDFEVSVKIKNTGYMDGKEIAELYINDKISSVITPVKQLKRFKKVFIKSGE
EITVTFKINAEELGFISPDGKLTTEAGEFDIFVGGNLSDLQKETINVI

Enzyme Prediction     

No EC number prediction in MGYG000001913_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	66	289	9.4e-76	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.59e-168	11	706	38	763	beta-glucosidase BglX.
COG1472	BglX	1.16e-96	18	399	1	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.66e-81	19	322	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.52e-75	65	703	73	774	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.36e-47	358	591	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ98611.1	9.86e-255	10	707	5	702
QNU67704.1	2.08e-247	8	707	13	725
BCJ94694.1	1.52e-245	6	700	7	700
AUG58356.1	6.67e-235	8	699	13	716
AOT70770.1	4.52e-210	9	708	14	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z9S_A	1.56e-156	9	707	26	787	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5XXL_A	6.03e-127	4	702	6	746	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.31e-126	4	702	6	746	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.43e-125	4	707	5	750	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.75e-124	8	708	4	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	9.66e-127	5	708	28	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.36e-126	5	702	28	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.03e-124	8	707	34	720	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.10e-113	3	700	31	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	3.29e-105	8	707	37	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001913_00318.