CAZyme Information: MGYG000001910_00450

Basic Information

• Species: Duncaniella dubosii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella dubosii
• CAZyme ID: MGYG000001910_00450
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	MGYG000001910_3|CGC1	49324.96	6.0301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001910	3154435	MAG	Denmark	Europe

• Gene Location: Start: 144135; End: 145430 Strand: -

Full Sequence      

MLAGVLLATVGSAFAATAPAKKASETPKHYSEWLTRSEMQRVPESYMLDFSNRPKWSYVM
GIELESMLDTYLKYGGDDIKDYCIQYTDTMISPDGVIRGYKLLDYNLDNVRTGHFVTRMY
QHFPENKNLKAMNTLMRQLDEQPRTKEGVYWHKAIYAYQVWLDGIFMGLPYRVLTASTIY
TPELAKPIYDDAVEQVKSTYDRTFDSKTGLNRHAWDESREMFWSDNETGLSQHCWGRAQG
WYTMALVELLDVLPEDYERRGEVIDLLTRTFDNIIKWQDPKTGTWYQVMDSPEREGNYLE
STCTSMFAYSLLKAARKGWVKDAKYREAGIKAYEGIVDNFIKENPDGTISLTDCCVVAGL
GPGISDAVLKAAPKVKENKRRDGSYAYYLSEPIRDNDAKGVGPFVWASLEMEDLGYNVDS
FKKGKKAGKKK

Enzyme Prediction     

No EC number prediction in MGYG000001910_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	412	5e-116	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.88e-86	30	412	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.38e-77	21	414	2	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43358.1	0.0	1	431	7	437
QCD40373.1	9.43e-248	1	423	7	428
QCP71476.1	9.43e-248	1	423	7	428
QQR09854.1	1.38e-201	24	415	463	853
ARE60790.1	1.38e-201	24	415	463	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.49e-87	56	414	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.00e-54	23	414	9	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.68e-53	55	414	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.28e-21	139	410	178	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	7.78e-12	140	352	143	341	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.19e-53	23	414	9	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.43e-32	167	410	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.43e-32	167	410	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000897	0.998124	0.000217	0.000295	0.000243	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001910_00450.