CAZyme Information: MGYG000001909_00904

Basic Information

• Species: QAKW01 sp003343605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAKW01; QAKW01; QAKW01 sp003343605
• CAZyme ID: MGYG000001909_00904
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		66713.3	5.1562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001909	1743116	MAG	Denmark	Europe

• Gene Location: Start: 2855; End: 4600 Strand: +

Full Sequence      

MVDLRMEYPRPQLRRKDWLCLNGSWEFEIDTAEVGTWQAFWNRDHLDGTILVPYCPESEL
SGVGHKEFMNCVWYRREFELPESFAGKRVILHFGAVDYLAAVYLNGKPVGTHKGGYTPFS
FDITDFLQPGKNALVVSATDHERSRKQPVGKQSQQLYSKGCSYTRVTGIWQSVWLEPVRE
ERLLRYRVYPDVSNSSVTLQLMVSGAAAGCTLRVEALYEGRLMGEAEAAVQSRAVTLTLP
LKERHLWEIGQGRLYDLHITLSDTRGLLDEAQGYFGLREVGLTEKGMTLNGAVFFGRYVL
DQGYYPDGIYTAPSDEALKNDILYSMQLGFNGARLHQKIFEPRFLYWADRLGYLVWGEHA
NWGLAVERADCLQDFLPEWLEAVERDFSHPSLIGWCPFNETWDHKETGAHQCDAVLEMVY
LATKAADPTRPVIDTSGNFHVQTDIFDVHDYEQDPELFRSYYAKISEGIVNDQCNRRFPK
RQVYRGGPIFMSEYGGIKWNTARVGDGWGYGAAVTSEEEFIARYRGLTDALLDNEHMMGF
CYTQLYDVEQECNGLMTYERKFKFDPEIFRAINSRKAEIEK

Enzyme Prediction     

No EC number prediction in MGYG000001909_00904.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	13	494	1.7e-96	0.535904255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	9.47e-41	6	432	1	445	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.88e-39	21	456	15	451	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.25e-22	50	432	99	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.80e-21	74	432	124	485	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	5.19e-20	21	175	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS26546.1	1.12e-246	5	580	11	586
ANY74929.1	3.44e-244	5	580	9	581
ANA78861.1	6.44e-244	5	580	8	579
AVV57223.1	6.44e-244	5	580	8	579
AYB42891.1	9.91e-241	5	580	8	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.86e-85	3	575	24	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3K4A_A	3.89e-31	21	448	17	464	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	6.94e-31	21	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	7.02e-31	21	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	2.23e-30	21	448	13	460	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	1.24e-29	21	448	15	462	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O18835	2.91e-23	6	495	27	541	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
P77989	1.09e-22	17	413	11	407	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	1.84e-22	21	503	7	472	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
O97524	5.01e-22	6	495	27	541	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001909_00904.