CAZyme Information: MGYG000001906_01761

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-484
• CAZyme ID: MGYG000001906_01761
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	MGYG000001906_34|CGC1	64965.19	8.7042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001906	2224684	MAG	Denmark	Europe

• Gene Location: Start: 11487; End: 13160 Strand: +

Full Sequence      

MNAITRTLDFVKKHPEWFTVLGLCILFYFIFFHNIGNYPLMDVDETRYVSMARDMFHTKD
FMTLILDDDYFFEKPPLFFWGECISFAVFGKINEFTARFPVALYGTLTCFLTYFMGRKIV
SRNYGVVSSLILATCFEFVILAKFAILDIVVSTCVAFSIMLGFLTFFCKEENKKFCIWLF
YIFSGLAVMAKGIPGFVLPFGVMFFALLLADKVKSALKPKYLLVGLTFFLLIVLPWHLLM
LKIHNPVFYEEYIIKHHLARFFTSNDIDRSEPVWFYFVNLIWGMVPWIFSALAILAVKCK
NFRLEIFKNFKFNFNELDDAKKYLILNWLAAIFILLFFSSSSTKLITYILPVYVHLACIL
GFAWLGYIEKDSNKKAINISVYIWGGVCIFLAVAALFTPLFLPEWLYNDIYQAKWLCIGF
VAFCGISSILCAIKHKPWGVFFTYVIFTMLVSAFCTKQFFLIDYKFGQNDLMEFAKYAHD
TKDQLISFGDTRRYSLLYYYGAHIKYIEELTQDNLEEELEKNDALISVKKKNLAKYGNGL
KYKTVLEGRKYILIRGK

Enzyme Prediction     

No EC number prediction in MGYG000001906_01761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	16	521	1.4e-96	0.9055555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.30e-40	12	397	6	367	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.78e-25	12	425	3	394	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	4.64e-13	74	236	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.03e-13	25	244	5	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	0.007	15	235	22	256	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	3.62e-219	9	555	6	555
ACM19911.1	4.48e-54	21	381	19	362
ABQ27847.1	3.18e-53	12	395	10	382
AJE04087.1	4.39e-52	1	361	1	342
QEM66831.1	2.80e-50	10	399	9	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.49e-21	17	421	27	418	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	9.41e-31	30	384	15	338	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B4ETL9	1.78e-21	23	439	14	414	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
C6DAW3	7.32e-19	25	439	15	411	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
Q7N3Q9	9.63e-19	40	456	31	418	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
Q6D2F3	1.72e-18	25	439	15	411	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000004	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
17	36
95	117
124	141
146	168
175	189
193	210
222	239
273	295
323	340
345	367
379	401
411	433
440	462