CAZyme Information: MGYG000001900_00714

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000001900_00714
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683	MGYG000001900_9|CGC1	77964.29	8.9872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001900	1885056	MAG	Denmark	Europe

• Gene Location: Start: 41741; End: 43792 Strand: +

Full Sequence      

MIKIFSPGIKKIKHLSSFLNEEMSRYCSPNVEAVIGWGHKPTAHRARVFAKENNLPYIAL
EDGFLRSLNLGVNGSSPIGLTVDTVGAYYDATGPSQIELWLNSADEWMTPKLFKRAHEAI
RLLIEYDLSKYNVSASLKKGEFRKQWGVSDTQRCVLLVDQTVGDASVELGLASHDSFYRM
LQDAINENPEAKIFVKVHPDVLAGKKEGFLTKQSLPENVTVIDQAWASLSFLSEFDRIYT
VTSQMGFEALMLKKEVLVYGCPFYAGWGLTEDRGAVTFRRGKKHSLETLFAAAYIRLSRY
VSPVTGESLQLEEAIDFLNTQRQCNERNRGLHIAMGFRRWKREHVRAFMASTNGKVEFVQ
NEDLALRHAIDHGGDLVVWSSRCHSNFLEKAKKRGVKVWRMEDGFLRSAGLGSDFNTPYS
LVLDCSGIYYDPSQPSELEHLLLGITDRKDFDRLVQRAEWLRDFLIKNRLSKYNLELENI
QWNQKVEGRKVILIPGQVEGDASVVNGGGKIQSNLDLVRVVRKNNPNAYIVYKPHPDVQA
KNRPGSLTKETLRAYVDYVAEKGSLDSWLRVIDELHTLTSLSGFEALIRGVAVYTYGKPF
YAGWGLTHDFESFPTRKKNLTIAALVAGALILYPRYWDWRSHQFCRPEDVCELFVRGELV
EPRLWVKFCRLFRDIKKRWCSYV

Enzyme Prediction     

No EC number prediction in MGYG000001900_00714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	302	662	3.8e-133	0.6672932330827067
GT107	22	326	4.4e-102	0.5526315789473685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	656	6	641	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	8.30e-143	374	636	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.54e-131	34	303	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	5.96e-90	376	636	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	7.61e-80	34	300	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF23574.1	8.14e-241	1	678	1	693
ABM29610.1	3.11e-211	4	678	15	680
AMK11041.1	8.39e-190	1	669	1	659
SOB62129.1	8.08e-184	1	675	1	665
SOB60069.1	1.51e-181	1	663	1	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGB_A	3.97e-82	2	318	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGC_A	4.56e-75	2	349	3	349	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGD_A	7.93e-65	337	636	9	300	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P57037	9.22e-167	6	656	28	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
Q05013	2.07e-165	6	656	28	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P42217	4.23e-160	1	656	1	643	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
P31858	9.12e-51	391	636	137	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001900_00714.