CAZyme Information: MGYG000001896_00339

Basic Information

• Species: UMGS1840 sp900555525
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; UMGS1840; UMGS1840 sp900555525
• CAZyme ID: MGYG000001896_00339
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45797.05	8.1919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001896	2208881	MAG	Denmark	Europe

• Gene Location: Start: 13489; End: 14697 Strand: +

Full Sequence      

MADIFYAFITAVRVSACFIAAYHFVISLFAWRKTKKKSVNNDNVYSFAVIVPAHNEEKVI
SAALKSIFCVNYDKNYFDVFVIADNCTDNTANIARESGAVVWERNNRLQTGKGHALKWGL
NKLYSYGKKYDAVCIADADNIMDRNFLSAVSASFGEGYDSVQGQIETKNPFDSWVTASYY
ITYLCVNKMYQKARHNIGFPVQLNGTGFAIKTELLKSVEWDESCLTEDIEITAELIKRNI
ITAYCEDALVYDEKPRGLMTSLRQRTRWMQGQSDAMARYFSQLVRAMKTVNPLKVFDCII
YLLQPLFFVMTGILTIVGIFDAFSFETFSAEKIIADGVLLLIQLCAVPLILLSEGKLNKK
TMLYYIPYLIFMYTWIPAAVSGIIKRREKTWFHTEHTVSTIN

Enzyme Prediction     

No EC number prediction in MGYG000001896_00339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	47	270	1.1e-34	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	7.17e-70	49	230	1	182	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	2.58e-41	49	228	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.66e-40	4	384	16	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	2.55e-29	47	271	4	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	5.99e-18	137	307	6	177	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA45844.1	4.60e-105	18	399	21	414
APQ97942.1	1.30e-104	18	397	21	412
AUM99816.1	1.30e-104	18	397	21	412
APQ73660.1	1.30e-104	18	397	21	412
AUM92039.1	1.30e-104	18	397	21	412

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.69e-21	31	395	41	412	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	4.44e-08	48	303	109	363	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q58619	7.67e-06	33	163	5	128	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
298	320
333	355
362	384