CAZyme Information: MGYG000001887_00565

Basic Information

• Species: Ruminiclostridium_E sp003512525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp003512525
• CAZyme ID: MGYG000001887_00565
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001887_4|CGC1	44674.76	5.65

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001887	2739679	MAG	Denmark	Europe

• Gene Location: Start: 48595; End: 49719 Strand: +

Full Sequence      

MAYTTDFEKLKEQLNYKPDPTKLVSKQASENTVKLFDYLKSIYGKKHLAGQQYLQSDEVE
DLVYYRLTGKLPAVRGYDFMGVSSCKKTDDQVDRAIKWATECGGIVTMCWHWYAPNDMND
YSKGSSFYYKTTGYDHKTCFDLCKGVTEGTEEYEFIIREIDMVSAELKRMADLDIPVLWR
PLHEANGNWFWWGNHDEKHREAYKKLWYMIFDRMENYHKLSNLIWVWNGQDKCMEVDPNT
FDICGDDIYSVKEYDHSSQKKRFEYMTELAHGKLITLSECGYIPEPDEMKKDNAMWLWWL
PWWGEFVYKRDGYKPVFDKDGYTVINEKYMTEDFMKRVMSHPDVIMREDLPWYDKDKHKF
PDALLTNLERIKSK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	24	348	4.1e-88	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.17e-42	24	304	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	1.01e-11	162	319	163	340	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL34792.1	4.30e-268	1	374	1	362
CBK96404.1	8.67e-268	1	374	1	362
CBK96003.1	9.86e-102	1	364	68	435
CBL34396.1	1.97e-101	1	364	68	435
AIQ56350.1	1.92e-78	10	351	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.66e-52	24	350	7	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	5.96e-47	28	307	150	421	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	7.43e-45	23	351	45	357	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	4.67e-41	24	351	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	1.09e-40	24	320	24	319	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55296	7.20e-52	17	356	152	466	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55297	3.02e-51	17	360	153	471	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	4.07e-51	19	360	153	469	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
G2Q4H7	1.31e-48	28	323	179	466	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	9.90e-47	21	307	26	324	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001887_00565.