CAZyme Information: MGYG000001878_01606

Basic Information

• Species: Parabacteroides sp900548175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900548175
• CAZyme ID: MGYG000001878_01606
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35028.33	6.9678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001878	3414068	MAG	Denmark	Europe

• Gene Location: Start: 30347; End: 31297 Strand: -

Full Sequence      

MMKVFLFSMLLACSWQAAAFRPMIQEEKRAAEYVNPFIGASTNVRDAGAYHGLGKTIPGA
TYPFGLVQLSPNTITGGDNGSGYSDEHESIEGFAFTQMSGIGWYGDLGNFLVMPTTGPMH
TNSGKLENPDAGYRSRYDKSSEHARAGYYSVYLSDYRIRTEATVAQRAGMLRFTFPEGKD
SRIQIDLARRVGGTSTWQEIKVVDDHTISGKMICTPDGGGWGNGDGKPDYTVHFYAQFSK
PLKNYGVWSVAIPEGQSRKREFIESEAFQQLTAGAEIHRQVSSFEGKHLGFFTEFATKQC
HLTELVDLNLFINKRG

Enzyme Prediction     

No EC number prediction in MGYG000001878_01606.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17678	Glyco_hydro_92N	1.06e-76	33	298	1	219	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
COG3537	COG3537	1.06e-29	7	253	20	242	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
NF035929	lectin_1	1.20e-24	31	246	8	193	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO15032.1	1.37e-140	26	298	33	304
ABR44849.1	1.37e-140	26	298	33	304
QUT97309.1	2.16e-139	26	298	33	304
QKH99385.1	2.16e-139	26	298	33	304
QUT20923.1	2.16e-139	26	298	33	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F91_A	2.66e-40	23	242	1	200	Structureof the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6F8Z_A	5.85e-26	32	242	9	198	Structureof the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2XSG_A	1.67e-12	54	187	24	163	Structureof the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans],2XSG_B Structure of the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans]
4AQ0_A	1.68e-12	54	187	40	179	Structureof the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans],4AQ0_B Structure of the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans]
2WZS_A	7.04e-12	32	186	5	145	Structureof the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_B Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_C Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_D Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_E Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_F Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_G Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482],2WZS_H Structure of the Family GH92 Inverting Mannosidase BT3990 from Bacteroides thetaiotaomicron VPI-5482 in complex with Mannoimidazole [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	4.33e-16	32	248	43	238	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001070	0.941291	0.056915	0.000263	0.000234	0.000217

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001878_01606.