CAZyme Information: MGYG000001873_01510

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia
• CAZyme ID: MGYG000001873_01510
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		32441.96	4.7892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001873	2665919	MAG	Denmark	Europe

• Gene Location: Start: 4827; End: 5699 Strand: -

Full Sequence      

MHYVCTINEANMGLQIAAISDRFKKQMMARMQQANSVKEAAKDVEGSVQVGLNMQKMMEN
MQKQSTENMEVFGTATPQVFVSARTPEGDLLVVRAHQAAKKAIKEVNPKLQVGITLSLHD
IQAKEGGEKNAAKEWESEFSHYVPYIKDDDFFGLQNYTRSVYDADGICAAPEGAPLTQMD
YEIYPQALENCIRRVAKELDIPIIVTENGIAVEDDALRVDFIGKATDGVAACIRDGIPVK
GYMYWSLMDNFEWQKGYSMTFGLISVNRETQERMAKPSLAYLGSLQEEAR

Enzyme Prediction     

No EC number prediction in MGYG000001873_01510.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	284	1.3e-51	0.6130536130536131

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	4.66e-35	95	281	199	442	Glycosyl hydrolase family 1.
COG2723	BglB	1.95e-32	95	278	202	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	9.51e-27	160	281	324	457	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	1.64e-10	181	280	365	472	beta-glucosidase
PLN02814	PLN02814	4.22e-09	179	285	365	480	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB29242.1	8.42e-127	1	287	149	432
CBL02685.1	9.01e-124	1	283	149	428
ADL34422.1	2.65e-123	3	283	151	430
AEN97245.1	1.23e-121	1	284	148	431
QTE67958.1	8.65e-119	1	283	148	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.13e-55	74	284	199	407	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	6.68e-47	91	285	235	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.32e-31	95	278	205	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6ZIV_AAA	5.97e-27	92	278	205	442	ChainAAA, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_BBB Chain BBB, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_CCC Chain CCC, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_DDD Chain DDD, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_EEE Chain EEE, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_FFF Chain FFF, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_GGG Chain GGG, Beta-glucosidase [Alicyclobacillus tengchongensis],6ZIV_HHH Chain HHH, Beta-glucosidase [Alicyclobacillus tengchongensis]
3WQ8_A	4.40e-26	92	278	241	444	Monomerstructure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_B Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_C Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_D Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_E Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_F Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_G Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_H Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_I Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_J Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_K Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus],3WQ8_L Monomer structure of hyperthermophilic beta-glucosidase mutant forming a dodecameric structure in the crystal form [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10482	1.95e-20	150	281	298	446	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
Q03506	2.59e-20	134	278	265	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
Q08638	6.40e-20	92	278	197	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P22505	6.47e-20	92	278	198	435	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
P12614	9.28e-20	95	285	205	445	Beta-glucosidase OS=Agrobacterium sp. (strain ATCC 21400) OX=74562 GN=abg PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001873_01510.