CAZyme Information: MGYG000001857_00626

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio
• CAZyme ID: MGYG000001857_00626
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000001857_27|CGC1	83382.76	5.7996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001857	1776473	MAG	Denmark	Europe

• Gene Location: Start: 7222; End: 9417 Strand: +

Full Sequence      

MIDIQSLADQCGIAREYYDVTGKTVVIDEQKRSQALSLLGYPIDDEQALLKKLKAQEIEP
YENMLDYVTVWRDGDYPFIYLRTRADLDANATVCWTLETENGERYTDTLPLEEIEIADYK
TIQGVEYDIRRLIIDKDLPYGYHRFSFNLTAAYGIYNSIVMSLIKAPLKAYDAQEFLDGK
KVWGVSVQLYALRSRHNWGVGDFGDLKLLLRQIARQGGHFVGLNPLHAGYPANPDPYSVS
PYSPSSRNWLNIIYINVEDIPEYSECKEAYELVNSKAFQQQLKALRQREYVDYRGVLDLK
LKVIKKIFDKQRIDDKRTNRGREFLKFIEEGGQSLLDMATYDALQASLYAKGVDAGGWQA
FPREYHSSLSPFVENWRNEHSREIRFYCYLQFLAKEQLHAAYKIATEEKMIIGPYRDLAV
GVASGSCDVWSDHDNLYCKDASIGAPPDPLGPLGQVWGLAPMSPKALQRVAYKPFIDLYR
RNMTDCGALRIDHAAGLNRFWWTKQGQTADQGAYVAMPMHDLLGIIALESQRHKCIIIAE
DLGTIPNELRVALSELGAYSYKLFFGERANDGGFIDPKLYQPHAMSALTTHDMATIKGWW
QGDDLSLGVRLNVYTQEEADKLKIDRENSKQRILDSMHGLGSIGNDIGFYAKDVPYSQDL
VTGMQVHMCRGSCTLYSSQLEDWIGVEKPVNVPGTYREYPNWKRKLTADLEDIFNNDYVL
KLCKSMTAARK

Enzyme Prediction     

No EC number prediction in MGYG000001857_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	187	728	3.2e-136	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11052	malQ	0.0	4	731	6	690	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	3	713	7	704	malto-oligosyltrehalose synthase.
COG1640	MalQ	9.37e-144	170	731	1	517	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	3.03e-132	187	709	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK14510	PRK14510	6.58e-128	170	711	709	1199	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLH68336.1	1.52e-225	4	730	5	724
ALP43607.1	2.16e-225	4	730	5	724
QCG49066.1	2.16e-225	4	730	5	724
QWL64136.1	6.12e-225	4	730	5	724
ANB67324.1	8.67e-225	4	730	5	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	4.35e-164	87	726	70	683	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	2.12e-158	87	726	70	683	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	6.24e-76	4	702	7	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	5.63e-164	87	731	70	688	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	3.37e-130	4	717	10	684	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P65337	4.31e-80	7	729	11	716	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	4.31e-80	7	729	11	716	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	4.31e-80	7	729	11	716	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001857_00626.