CAZyme Information: MGYG000001851_00921

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880
• CAZyme ID: MGYG000001851_00921
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000001851_32|CGC1	57929.28	7.208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001851	1612023	MAG	Denmark	Europe

• Gene Location: Start: 6702; End: 8240 Strand: +

Full Sequence      

MAAKKTTETQEKITEKKPAAKKPAAKKTSRPRAKKPEMPRILFASAEVNPFSQTGGLGEV
AGSLPVAVNASGEAVMAVVTPLYECIGQEWRKNFEFICHINVPVAWRSQYAGLFKFVYRG
VTHYFIDNEYYFKRPNLYGYYDDAERFAFFTRAVLELMPHMDFRPNILHSNDWHTALVPI
YYKLYYMRAAGYEGIQNLITIHNIEYQGKYDGYLLEDVFGISGFEYYTLEWGGCVNLLYG
AIAYSDMVSTVSRTYAQELRGAAHACGLENAIDRYAYKLTGIVNGIDTEVYNPETAPALF
AHYSAEKPELKAENKRGLQRLLGLPERPDVPLITMVTRLAGHKGLDILKQAMPRLIKEDI
QFALLGTGEPEYEGFFMSLQNACPDKARALIKFDKDMSQKLFAAGDIYMMPSRSEPCGLG
QMMAMRYGTIPVVRNVGGLADTVREGEDGNGFVATEHTGDSLYDATMRAVNAYRDRDGWK
EIVRRAMTEDWSWSRSGREYIELYKKMLADPK

Enzyme Prediction     

No EC number prediction in MGYG000001851_00921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	40	506	2e-163	0.9978813559322034

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	40	506	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	40	509	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	40	506	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	8.80e-169	40	512	2	483	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.37e-102	40	509	5	481	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243454.1	1.68e-165	40	508	2	472
ARP51332.1	4.63e-165	40	510	2	474
QKN23272.1	4.63e-165	40	510	2	474
QKO30046.1	4.63e-165	40	510	2	474
QNO18264.1	7.52e-164	40	510	2	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	1.07e-86	41	510	127	628	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	4.37e-80	41	509	12	499	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	2.94e-79	40	507	2	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.92e-78	40	510	2	479	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	3.01e-77	40	510	2	479	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6HC18	1.95e-139	41	508	3	475	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2
Q816G8	3.90e-139	41	508	3	475	Glycogen synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=glgA PE=3 SV=1
B7HBC4	3.90e-139	41	508	3	475	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1
Q81K85	3.90e-139	41	508	3	475	Glycogen synthase OS=Bacillus anthracis OX=1392 GN=glgA PE=3 SV=1
A4IS20	1.05e-138	40	508	2	475	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001851_00921.