CAZyme Information: MGYG000001848_00353

Basic Information

• Species: Eubacterium_F sp000433735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp000433735
• CAZyme ID: MGYG000001848_00353
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		36018.11	10.4951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001848	2356822	MAG	Denmark	Europe

• Gene Location: Start: 383008; End: 383976 Strand: +

Full Sequence      

MKKRYIGFLFLLLLLCPCFTVHTASAASPVAKWGRLQVKGTQIVSDKGKKVQLKGVSTHG
IAWFPQYVNKSSFASMKRMGANTIRLAFYSDPAAGYDAGLYKKVEEGIQAATGLGMYVVL
DWHILSDGNPKIYEKNAGKFFTYFSRKYGKQKNILYEICNEPNGNVTWAKDIKPYARRII
KKIRKYDKKNIIIAGSSTWSQDVDQTAKSPLKGKNIAYSLHFYAATHKEDLQQKLKTAYK
AGLPILVTEFSICDASGNGAIDKSSGKKWIKLLKKYKIGFIAWSLCNKQESASLLKASCS
KTGNFKKSDLSKTGKWILAQMK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	47	280	7.3e-82	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.86e-65	44	288	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.77e-14	70	316	76	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	0.003	60	123	55	125	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	0.003	73	184	30	157	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00780.1	1.10e-102	26	321	211	512
QWT53734.1	8.80e-102	24	321	209	512
SIP56455.1	4.21e-99	34	317	85	373
CBK83877.1	1.31e-98	29	317	227	523
CBK89462.1	5.43e-98	34	317	89	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XZW_A	4.12e-96	28	321	4	302	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	7.41e-95	22	317	20	320	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZB_A	7.90e-94	28	321	4	303	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
6GJF_A	9.45e-90	27	322	4	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1A3H_A	3.68e-75	28	317	1	293	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	7.81e-91	24	317	30	325	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	9.76e-89	24	317	30	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P07983	1.94e-88	24	317	30	325	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	2.65e-85	8	317	15	331	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
Q59394	6.54e-79	23	322	28	329	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000705	0.573129	0.425278	0.000331	0.000300	0.000236

TMHMM  Annotations     

start	end
5	27