CAZyme Information: MGYG000001846_00330

Basic Information

• Species: CAG-1435 sp900769665
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-1435; CAG-1435 sp900769665
• CAZyme ID: MGYG000001846_00330
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761	MGYG000001846_7|CGC1	86136.57	4.5664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001846	2118081	MAG	Denmark	Europe

• Gene Location: Start: 17575; End: 19860 Strand: +

Full Sequence      

MGEFVCMTNKLLLNGQYELYSFDSAVAPSAPDKLYGEPITATVPGNVELDYMSAGLLSDL
YVYDNIDAARTLERKDFWYVKQFDFTPDPSARKRTLTFDGVDCIAEYFVNGTKIGASDNA
LASHSSDVTDVLVKGVNTLAVHIFSAVEYAKQYKIAPYNVAFDGCYESLNVRKSAASYGW
DILPRAVSAGIWKDVYLTETIGAEIDSVYIATARAESDVAVLVVSVNADIPDEYIGKCKL
TVSGNSGCNKFSYTYPFSFNTATVYPYVYNPKLWYPKGSGEQNLYDISVEITCNGKVLCS
RSLRYGIRTAKLVFGEEVGQDGNFYVEVNGKKVRIRGVDHTPINVYHSRDLAKTAEVVND
IAEVNCNLVRIWGGGVYENDLFYDLCDEKGILVWQDVMLACHAYPQTDDFLKKIEAEVKS
VAMRLRNHTCLLNWCGSNETDWAYVCVGLDPNDDKVTRNAIAEALCQTDTYRTYLPSTPY
FSRNFVREYGERFYLDLDEITEQRRALPQEHYWWHRDDFKNFTDQTHKFIAEIGVSGAPS
DSLLNRVLPEGWDFVADDGWKNHSYPTESTRSTGINYLFTDVPQTNVDMAEASRLYQAEA
YKFIVEKCRIKTWQNGIVLWNLRDGYPIFASSLVDFDGWRKPAYKYVAASYEPIQCLFDI
NDDSVDLYVVNDGTFEGQAYLRVEDNLNTVVFEGEVSTTPDSIVKVASIFIADGNALISS
LTYNGQTTINFAYVYKNSIDYKRYKRWYDCTINKSTEEEKV

Enzyme Prediction     

No EC number prediction in MGYG000001846_00330.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	10	687	7.6e-74	0.6542553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.33e-41	13	481	15	455	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.78e-15	11	442	42	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.93e-07	79	439	124	462	beta-galactosidase.
pfam00703	Glyco_hydro_2	1.30e-06	205	308	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	0.001	78	144	68	134	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23305.1	3.22e-115	13	751	35	799
AZN42912.1	5.03e-115	5	747	13	766
AGB28636.1	2.90e-107	11	685	27	726
QQR15691.1	4.34e-106	2	746	18	789
QNL40264.1	4.34e-106	2	746	18	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.50e-77	41	689	46	689	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	6.67e-72	41	672	28	672	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.86e-72	41	672	30	674	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.96e-72	41	672	30	674	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.76e-71	41	672	28	672	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	3.04e-53	44	654	32	660	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q5B7W2	7.08e-50	30	654	22	656	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	9.69e-50	43	654	32	656	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q95327	1.63e-49	39	683	40	720	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	1.31e-48	39	654	40	691	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001846_00330.