CAZyme Information: MGYG000001814_02414

Basic Information

• Species: COE1 sp900753305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; COE1; COE1 sp900753305
• CAZyme ID: MGYG000001814_02414
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000001814_21|CGC2	32112.51	4.6716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001814	3758087	MAG	Denmark	Europe

• Gene Location: Start: 17813; End: 18637 Strand: -

Full Sequence      

MKKIILKIFVIVLFVILLRGCFENTSKAMEKYVVLIGEDSNVIDKITNIDVLIIDAEYFS
KDEISHLKKNGVNEIYSYLNIGSIENFRPYYAEYEEYTLGEYENWPEEKWIDVSNPKWQE
FVASRVNDLVQKGVDGFFIDNVDVYYMYQKESIYDGIINILKDIKNFDKKVIINGGDIFV
KKYLEKGKNKLIDGVNQENVYTMYDFSNDSYSKNAKDTREYYTNYLDLVIQHGCTAYALE
YATNSVIQREAEKYAKTHGYICYVSDNIELKLEK

Enzyme Prediction     

No EC number prediction in MGYG000001814_02414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	50	266	2.6e-60	0.9821428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03537	Glyco_hydro_114	1.17e-24	49	145	17	112	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG3868	COG3868	1.02e-18	48	226	79	259	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
COG2342	COG2342	2.48e-18	26	273	22	288	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
TIGR01370	TIGR01370	2.53e-09	55	265	79	303	extracellular protein. Original assignment of this protein family as cysteinyl-tRNA synthetase is controversial, supported by but challenged by and by subsequent discovery of the actual mechanism for synthesizing Cys-tRNA in species where a direct Cys--tRNA ligase was not found. Lingering legacy annotations of members of this family probably should be removed. Evidence against the role includes a signal peptide. This family as been renamed "extracellular protein" to facilitate correction. Members of this family occur in Deinococcus radiodurans (bacterial) and Methanococcus jannaschii (archaeal). A number of homologous but more distantly related proteins are annotated as alpha-1,4 polygalactosaminidases. The function remains unknown. [Unknown function, General]
cd14745	GH66	0.004	112	174	135	205	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04260.1	5.61e-112	35	272	1	238
QHI71547.1	2.65e-73	9	270	4	271
AOZ95737.1	2.65e-71	2	271	8	286
ASS41767.1	4.69e-67	11	272	4	268
ADU22174.1	4.11e-66	20	270	23	274

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000048	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	22