CAZyme Information: MGYG000001806_01900

Basic Information

• Species: Prevotella sp900553965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900553965
• CAZyme ID: MGYG000001806_01900
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		66702	5.1716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001806	3097082	MAG	Denmark	Europe

• Gene Location: Start: 8394; End: 10244 Strand: -

Full Sequence      

MNRLLALLFSAAAATAVMGQDKTPAFPGAEGFGRYATGGRGGNVYYVTRNDDCTDNNLVE
GTLRWALRTGDDTPRTILFKTCGTIYLNSVLKFAHPNVTIAGQTAPGGGICIAGYNIYVC
KPNVILRHLRFRAGDLAAKSRTALDIENTRNVIIDHCSMTWSMEECMTMYDCDSTTVQWC
IIGEGLYNSRNAKGARSYAMQWGGEHTSMHHTLITNCNNRMPRFNGVRSESKNRGDHDQF
VDSEFYNNVIFNWGKSNSLYGGECYTDINGGDSYNRIYMRGNYFRPGPNTQKNVQKNRYF
FQGDNSTKGTGQWLVEGNVFEKGSQYATAKNSCWTDATLDKVNADNWYGFTTNSADKAVN
IGAGNNQANYDKYALTEQTVTSGLVAEDAAVAYARVVGVLDTPTDGLTLFHGHGCAGATL
PRIDEVDSRLLSEAAGLVEPQFAGRDANGNLSRGMGVIDSPADVVLTEHDTFEALHETTG
TGVGEVKTTTMWPYLGLREGDRLIEDTDGDGLPDAYEREKGLNPGDASDGAALTADGYTN
LEVYLNGIADGTILKSDYETVESGIARTATAGATAVARTYYNIGGVETVAPSAGQVSIVR
ERLSDGKVSVKKVAGR

Enzyme Prediction     

No EC number prediction in MGYG000001806_01900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	83	269	6.9e-63	0.9562841530054644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	8.51e-04	23	223	28	235	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	0.004	76	284	3	186	Amb_all domain.
pfam00544	Pec_lyase_C	0.005	97	226	35	178	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75604.1	3.03e-142	25	552	38	536
QGW28869.1	3.83e-92	22	546	21	457
QNA45667.1	7.35e-92	25	550	24	461
ALJ01754.1	2.23e-91	20	549	14	461
AEV99914.1	1.46e-86	25	548	31	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	7.68e-07	30	253	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	2.10e-29	25	552	23	418	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	2.10e-29	25	552	23	418	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	1.28e-28	25	548	22	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q5B297	8.04e-28	1	548	4	410	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
A1DPF0	3.57e-27	25	552	23	418	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000215	0.999125	0.000156	0.000176	0.000161	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001806_01900.