CAZyme Information: MGYG000001800_00771

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-631; CAG-631
• CAZyme ID: MGYG000001800_00771
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		59984.47	5.3938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001800	1543798	MAG	Denmark	Europe

• Gene Location: Start: 39524; End: 41056 Strand: -

Full Sequence      

MFQYHKEIPFIKDEYWWGGIIDEGVYMPYNQNHSLRNLNESNFGNQVTSFFISSKGRYFY
SNEPIQYIIKERVLIVDSMEEIFLEDKQSNLREAYYDWFHKYIKKDGKHPLMDMFVLPQY
NTWIEMNWKPTQEKILKYAHEIIDNGYQPGILMIDDGWQEDYGVWEFNSKSFSNPKEMIK
ELHSLGFKVMLWIVPCVSPDSLTFRENESKKIFYRKKNCEEVQIMHWWDGYSAVLDLTNP
EAIKWLKSQCDRLQNEYAIDGFKFDGADDDFYPYEGKFFKEMPRVHQSRLYSEFASQYAL
NEMRACFNTQGKALAQRLTDKRHSWNDRGINTLIPNAIAMSNLGYIFNCPDMIGGGLVGD
FVDDQFQIDEELFVRYAQVATFFPMMQFSLAPWKALSIKNNQIVHKCCQIHESLKDDITL
FVKEAANKGTPILRSLCFEFPDGGFENIKDQFMLGDKYLIAPIVTKNTYSREVVLPKGKW
LDDLGKVYEGGQCITISVPLERVPYFIKQN

Enzyme Prediction     

No EC number prediction in MGYG000001800_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	95	509	1.5e-81	0.9695550351288056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	2.23e-150	118	480	3	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	6.43e-58	101	510	250	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	7.53e-54	154	510	64	439	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06597	GH31_transferase_CtsY	4.00e-33	123	402	14	305	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
PRK10426	PRK10426	8.01e-26	165	510	261	620	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU29504.1	1.92e-155	3	508	19	520
QHQ60753.1	7.12e-154	7	509	6	507
AIQ45863.1	5.52e-148	1	506	1	504
ASM64939.1	1.55e-147	6	508	23	526
QQT78550.1	1.55e-147	6	508	23	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	3.45e-28	162	508	427	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
6JR6_A	3.02e-26	151	510	299	685	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	1.71e-25	151	510	299	685	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5I0D_A	2.66e-24	162	508	427	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	2.69e-24	162	508	448	818	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69ZQ1	5.53e-63	101	506	298	712	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
Q6NSJ0	1.43e-62	101	506	299	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
P19965	3.83e-29	224	510	393	682	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
Q9F234	3.68e-26	97	510	242	671	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P96793	2.41e-17	50	510	197	671	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001800_00771.