CAZyme Information: MGYG000001798_01078

Basic Information

• Species: Ruminococcus_D sp900752625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900752625
• CAZyme ID: MGYG000001798_01078
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40533.62	4.3287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001798	2367577	MAG	Denmark	Europe

• Gene Location: Start: 13408; End: 14475 Strand: +

Full Sequence      

MKIKKLLGFIISTVMLCGCGTSSYTGSRDFASEAASSAESYDTEIPDDHSETESDFAMEI
PAGLEEIPSDYYSQADRQGTLEELNYETYESFSYEEKTQKLNKRAIVYLPYGYNENEQYN
IFYLMHGGWSDETTALGTPDSPNQMKNVVDHAIEDGRMQPMIIVCPTYNNTSSDDSSNFS
LAMDLTRNYYNELLNDLIPAAEGKYHTYADSTSAGDLAASREHRGFGGFSMGSVATWWTF
RNCLDYFKYFMPMSCGAVLDDEYIFKTARGYSQNDYFVFIMTGTDDFAYSYDNDRVDKMR
SSEYFTEGRNFAYRVKDGYSHDGLASMEYTYNGLIRFWNTRNTAVFPYKLSGQKR

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	101	321	1.8e-25	0.8854625550660793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	2.00e-11	102	338	81	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADA67819.1	2.56e-114	58	302	34	280
AEY68182.1	1.19e-51	67	332	407	679
QNU67689.1	3.78e-51	67	339	322	601
AEV68181.1	6.46e-51	67	332	1217	1493
QSF48012.1	1.11e-50	67	332	351	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GKL_A	1.19e-49	54	339	14	288	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
1GKK_A	2.98e-46	54	339	14	288	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1GKK_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],3ZI7_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],3ZI7_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],4BAG_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4BAG_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4H35_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],4H35_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],5FXM_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_AAA Chain AAA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_BBB Chain BBB, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
6FJ4_A	4.06e-46	56	339	2	274	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
6NE9_A	9.00e-09	58	250	122	286	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
5CXU_A	7.65e-08	76	233	12	159	Structureof the CE1 ferulic acid esterase AmCE1/Fae1A, from the anaerobic fungi Anaeromyces mucronatus in the absence of substrate [Anaeromyces mucronatus],5CXX_A Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_B Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus],5CXX_C Structure of a CE1 ferulic acid esterase, AmCE1/Fae1A, from Anaeromyces mucronatus in complex with Ferulic acid [Anaeromyces mucronatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51584	2.64e-45	54	339	802	1076	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
D5EXZ4	3.16e-10	58	292	409	630	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001798_01078.