CAZyme Information: MGYG000001798_00237

Basic Information

• Species: Ruminococcus_D sp900752625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_D; Ruminococcus_D sp900752625
• CAZyme ID: MGYG000001798_00237
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		39881.72	4.98

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001798	2367577	MAG	Denmark	Europe

• Gene Location: Start: 104168; End: 105202 Strand: +

Full Sequence      

MKKWNGYQKGVNLGGWFSQCDYSEERFNNFITEDDFREISKWGLDHVRIPIDYNLVETED
GTFKESGFAHLDRAVGWCGKYGLNMILDLHRTAGYSFDSESGKNTFFDDGKLQERFYRLW
EELAERYSKYSRRLAFELLNEVTDQSYSEAWNSISAEAIERIRKISQDVTILVGGYWNNS
IDALKDLRPPRDENIVYNFHCYGPILFTHQHAYWAGGLGKMPEDVHVVFPDTVQSYLDTI
SKYVPGGIFTGDIERHKLLGEEYFEACFADGIKLAEERNVRLYCGEYGVIDHADLQSTVN
WYKAINSVFVRHGIGRAAWSYKEMDFGLSDKRMKPVIDEIISLL

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-	3.2.1.74

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	326	3.2e-134	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.68e-30	4	321	1	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	9.21e-24	7	330	51	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61786.1	6.09e-134	1	344	1	340
QPZ86390.1	6.35e-132	1	342	1	342
ADU22290.1	1.95e-130	1	344	1	341
EGC02962.1	4.53e-129	1	344	1	341
ADX05739.1	4.52e-128	6	344	7	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.35e-83	7	344	4	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.51e-82	7	344	4	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	5.31e-30	8	327	11	289	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMC_A	1.85e-28	9	326	14	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AZR_A	1.31e-27	9	326	14	288	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	4.63e-101	1	316	1	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P0C2S3	5.86e-82	7	344	4	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
A3DJ77	1.66e-81	7	344	4	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	1.66e-81	7	344	4	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P25472	6.28e-27	10	319	38	297	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001798_00237.