CAZyme Information: MGYG000001790_00098

Basic Information

• Species: Phascolarctobacterium_A sp900553055
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900553055
• CAZyme ID: MGYG000001790_00098
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		28786.87	6.6939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001790	1816593	MAG	Denmark	Europe

• Gene Location: Start: 26147; End: 26890 Strand: -

Full Sequence      

MQVTVVILTKNEENNIIGVIENAKRITNTVLIIDSGSTDNTVSLAEANGAKVVYREWDND
FSAQRNFALKHVDTEWVLYLDADERLDDELCNSIKKVVIYGQQMQYSIVRKIHAFGFEYK
HGIFKPDEVLRLFPTKTVHWENKVHERPICALPKEKLAGFIEHYTYSSWQQWWDKAGEYT
TIWAEDSFAKGKRTSLGECLGHSIYGFFRAYIIQLGFIDGWSGLYSSLQHFIYTMMKYLK
LYELQLK

Enzyme Prediction     

No EC number prediction in MGYG000001790_00098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	91	3.2e-18	0.5647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	9.77e-72	3	227	2	229	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
COG0463	WcaA	4.47e-18	1	244	3	254	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	3.63e-17	4	98	1	100	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.29e-17	5	140	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
TIGR04195	S_glycosyl_SunS	1.85e-14	3	149	59	204	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG62446.1	6.41e-118	2	244	3	245
QNP77235.1	1.27e-115	2	247	3	248
QTV78199.1	1.45e-98	4	245	6	247
CCC73969.1	1.87e-96	5	247	6	249
AVO75335.1	1.87e-96	5	247	6	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	7.57e-11	3	149	56	201	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	9.40e-11	3	149	56	201	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44029	2.41e-36	3	243	4	248	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
Q9XC90	3.61e-27	30	244	31	248	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1
Q68XF1	2.00e-25	2	247	3	260	Uncharacterized glycosyltransferase RT0209 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0209 PE=3 SV=1
O05944	4.02e-23	2	247	3	260	Uncharacterized glycosyltransferase RP128 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP218 PE=3 SV=1
Q92IX8	4.72e-23	2	245	8	260	Uncharacterized glycosyltransferase RC0292 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0292 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001790_00098.