CAZyme Information: MGYG000001780_02003

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001780_02003
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001780_12|CGC1	28660.11	8.4291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001780	6261722	MAG	Denmark	Europe

• Gene Location: Start: 48922; End: 49692 Strand: -

Full Sequence      

MKRIISVVCVLFSLLSLSAQETYQKETFISSRGDTLPYRLLRPETVKAGEKYPLVLFLHG
AGERGNDNERQLTHGGQMFLNPVNREKYPAFVLVPQCPESGYWAYMERPASFMPGEMPLD
NPLTPVFQTVKDLLDTYLAMPQVDKNRVYIIGLSMGGMGTFDMAIRYPEIFAAAVPVCGT
VNPARLKAAKQVKFRIFHGDADNVVTPEGSRAAYKALKAAGADVEYIEFPGCNHGSWNPA
FNYPGFMEWIFSQKKK

Enzyme Prediction     

No EC number prediction in MGYG000001780_02003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	236	1.6e-29	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.35e-50	14	254	157	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	8.22e-19	27	235	369	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0412	DLH	2.46e-14	25	243	3	210	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	1.20e-13	53	231	19	186	Predicted esterase [General function prediction only].
COG3509	LpqC	2.66e-11	15	209	32	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	7.98e-54	36	256	22	246
BCI61582.1	2.81e-46	18	254	806	1042
QJW99051.1	2.88e-36	23	255	34	240
VTR91196.1	7.41e-33	36	255	43	239
ACR12533.1	3.95e-32	17	254	42	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	4.59e-51	33	255	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	7.34e-30	32	256	17	218	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	9.75e-12	50	255	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	7.71e-08	134	246	112	228	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	3.78e-06	131	234	600	708	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998922	0.000254	0.000160	0.000157	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001780_02003.