CAZyme Information: MGYG000001775_01509

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum
• CAZyme ID: MGYG000001775_01509
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000001775_49|CGC1	42015.48	8.4488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001775	2417274	MAG	Denmark	Europe

• Gene Location: Start: 11401; End: 12549 Strand: -

Full Sequence      

MHYFISAGEPSGDLHAAALIESLKACDPQAGFTFLGGDLMSAAVGCEPVIHYKRMAFMGF
SEVLRNLRTIFANFDTAKKAIDASRCDALILVDYPGFNLKLARYARKAGVPVFYYIAPKV
WAWKEWRVRQLRRDVRHVLSILPFEVDYFRGKGVKVSYVGNPSREEVDARLSSMPSFDEF
IGRHGLDGSRPLLALVPGSRRGEIKNNLPIMDAVARLHPEMQAVVAGAPGIDRAYYDSFT
TLPVIEGDTFGLMRNATAALVTSGTATLECALAGTPQVVCYRANGVKFSYNIMKHLLKVR
YVSLPNLIADAPVIPEMLVHLCTVEAVNDKLTDILPGAPGRDRQLAGYAVMRERLGTQAA
AESAARIIVNDLKNENHGDNRD

Enzyme Prediction     

No EC number prediction in MGYG000001775_01509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	6.7e-110	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.44e-116	1	375	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.30e-106	4	369	5	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.39e-79	4	368	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.55e-68	5	365	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.15e-58	1	370	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	2.35e-155	1	368	1	370
ASB37800.1	2.35e-155	1	368	1	370
ANU64105.1	2.35e-155	1	368	1	370
QCD36425.1	1.06e-152	1	372	1	374
QCP71596.1	1.40e-140	1	363	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.73e-39	7	368	13	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.73e-39	7	368	13	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.74e-70	5	369	9	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	3.71e-67	5	369	11	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.07e-66	5	372	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q02AZ6	3.86e-66	5	372	6	372	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q74AT9	1.28e-64	5	372	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001775_01509.