CAZyme Information: MGYG000001771_00323

Basic Information

• Species: CAG-617 sp000438115
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000438115
• CAZyme ID: MGYG000001771_00323
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		80126.47	7.2125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001771	1494481	MAG	Denmark	Europe

• Gene Location: Start: 20002; End: 22128 Strand: +

Full Sequence      

MKNVLFTAFFAGMALCASAQKTVFVSPTGNDAWAGDRNRPFKTLNRAFAESENSRDTLYI
QVASGDYFLEKSLDLSGGLTCPVVVKGNEKNKPRFLGGIKIQQWEKCRDGVYRAFVPEVK
RYGYQFEQFFVNGVRAVQARTPNKDWFYVKGSEEYPYVSGVRSANYATQKIVMDKQDLKS
LSGLSADELADVRFRFYHKWDITQKEAAYACPDSGFVYFHGGGMQPWNPISNGARYIMYG
YKAALDAPGEWYLDKADGYVYYMPREGENLETAECIVPTLHQWIVVKGHSGAALKDIRFE
NLSFQYAAYLMPKFGYEPMQAAAIVEAAIELEYADNVTFANCEMQHTGGYALWFKAACTD
NTIDHCYIADLGAGGIKIGSPWYTSDSTLICRRNVVNNSIITHAGSELPCGVGVAIFHAS
DNKVTHNEISDLRYSGVSVGWIWGYNNSDEIWTNVLMKDGTVDFAQVRLVSPAVRNLIAY
NHIHHIGWGELSDMGAVYTLGESHGTRIVNNIIHDVLSYDYGGWGLYTDEGSTGVEMSSN
LVYRCKSGGFHQHYGKENRIENNIFAFGHYYQVQYTRVEDHLSFHFRHNIILQDQGETLA
GPWENGKIDMDYNLYWHLNGKPQFGKHTFQEWKKLKEKHSVIMSPGFKDAQNDNYSFASL
KAARKIHFKPFDLSKVGVYGSAEWKEKAKMSVQQLDLFKEIAKVRLKK

Enzyme Prediction     

No EC number prediction in MGYG000001771_00323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	22	543	3.6e-97	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.80e-11	358	563	8	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.42e-09	331	439	28	120	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.32e-06	413	591	2	134	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	6.21e-06	382	575	25	181	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam07602	DUF1565	3.46e-05	28	92	2	63	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA25764.1	4.26e-199	1	693	1	677
AKP49975.1	1.80e-192	21	708	36	713
AEL24383.1	7.19e-192	22	698	37	703
SCM58138.1	8.07e-191	14	703	14	702
AWO00314.1	3.01e-186	18	705	32	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.81e-43	23	540	27	580	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001297	0.650702	0.347079	0.000356	0.000277	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001771_00323.