CAZyme Information: MGYG000001768_01162

Basic Information

• Lineage: Bacteria; Elusimicrobiota; Elusimicrobia; Elusimicrobiales; Elusimicrobiaceae; CADBRU01
• CAZyme ID: MGYG000001768_01162
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		31193.7	10.0507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001768	1168520	MAG	Denmark	Europe

• Gene Location: Start: 83; End: 943 Strand: +

Full Sequence      

MIAAAENEGVPVILLNARISRKSTKAYAYVRPLFKMLFGRVALACMQDADAAARYKTLGL
PRERMRICGNVKYDTLNDTPAKLKEAQALLKQLGWEKAPVLVCGSTHPLEEELILKAAPK
WAEAGIKIIFAPRHLERKEEIKAALSAQPLAYALVSEKKRPKNCVLLCADVMGLLQSLYA
VGRLAFVGGSIAPRGAHNLLEPAILGKTVLFGKSFHHTPDVAHALLSAGGGVLVDEENLE
RTVLRLFKDPAALENMAAKARLTALKFKGATQKTMEAVENYERKSA

Enzyme Prediction     

No EC number prediction in MGYG000001768_01162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	1	74	5.6e-20	0.4124293785310734

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	1.82e-69	1	281	139	420	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	4.70e-63	2	281	139	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	8.61e-23	1	74	102	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
PRK00726	murG	7.16e-04	222	284	292	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03786	GTB_UDP-GlcNAc_2-Epimerase	0.001	50	259	151	348	UDP-N-acetylglucosamine 2-epimerase and similar proteins. Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family (EC 5.1.3.14) are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT50610.1	2.79e-112	1	286	141	426
ACC98108.1	2.92e-72	2	283	142	423
ABA88509.1	2.74e-42	1	278	140	423
BBL70244.1	3.17e-42	1	281	137	419
BCA80117.1	3.75e-42	2	275	141	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.21e-20	2	237	115	333	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	4.86e-15	81	281	25	230	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44806	3.25e-34	10	281	148	422	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
F0T4D1	6.84e-34	2	281	149	427	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) OX=331636 GN=waaA PE=1 SV=1
Q46222	1.77e-29	2	281	149	430	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia pneumoniae OX=83558 GN=waaA PE=1 SV=3
P0AC77	2.04e-28	1	281	137	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	2.04e-28	1	281	137	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001768_01162.