CAZyme Information: MGYG000001766_01100

Basic Information

• Species: UMGS1976 sp900556765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1976; UMGS1976 sp900556765
• CAZyme ID: MGYG000001766_01100
• CAZy Family: CBM50
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
99		11244.93	8.4206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001766	1619445	MAG	Denmark	Europe

• Gene Location: Start: 394; End: 693 Strand: -

Full Sequence      

MVVIYTVKEGDSLYTIARRFGIPVEELARFNGIRDADRIMVGQRIRIPVGPTPDYYTVRS
GDTLFTLANRFGTTVDNLVELNEIADPSLIYPGQRLRIR

Enzyme Prediction     

No EC number prediction in MGYG000001766_01100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	5	48	1.2e-17	0.975
CBM50	56	98	1.1e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00257	LysM	2.31e-18	4	47	1	44	Lysin motif.
cd00118	LysM	2.13e-17	3	47	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.48e-17	55	98	1	44	Lysin motif.
pfam01476	LysM	4.58e-17	5	48	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	6.37e-17	55	98	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK16471.1	3.28e-24	2	98	226	325
ADL13349.1	5.54e-24	5	98	72	171
QEG13524.1	3.05e-23	5	99	222	317
ALP93086.1	5.14e-23	5	99	236	330
AYD80952.1	5.71e-23	5	99	219	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	9.96e-08	5	48	5	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
5JCD_A	2.74e-07	4	98	84	191	Crystalstructure of OsCEBiP [Oryza sativa Japonica Group],5JCD_B Crystal structure of OsCEBiP [Oryza sativa Japonica Group],5JCD_C Crystal structure of OsCEBiP [Oryza sativa Japonica Group]
5JCE_A	4.08e-07	4	98	84	191	Crystalstructure of OsCEBiP complex [Oryza sativa Japonica Group],5JCE_B Crystal structure of OsCEBiP complex [Oryza sativa Japonica Group]
4XCM_A	4.98e-07	5	48	5	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
4S3K_A	5.99e-07	4	52	6	54	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	2.30e-13	5	99	363	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q5HRU2	8.34e-13	4	98	85	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	8.34e-13	4	98	85	190	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q4L3C1	8.51e-13	5	98	30	131	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
O34669	1.80e-12	6	99	29	122	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001766_01100.