CAZyme Information: MGYG000001762_00930

Basic Information

• Species: Anaeroglobus geminatus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Anaeroglobus; Anaeroglobus geminatus
• CAZyme ID: MGYG000001762_00930
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000001762_6|CGC1	59299.45	9.5226

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001762	1764081	MAG	Estonia	Europe

• Gene Location: Start: 62136; End: 63713 Strand: +

Full Sequence      

MKAVVNYILNNRYGLSVFFLAAIFLLPFLGMFPLIDPDEPVYGQTAREMLAAGDWLSPRI
YGNFWYDKPPLFYWLEMISYSLFGISDYTSRLPSAIMGLATIGTVYIQCRAIFNKHIAFR
AAVVLLTSLGFIYIGKAAVTDMTLVFTLTFTMLAFYRKQYYTAYAGCGLALLAKGPVGYA
FPAIIMLLYIIFTRRWTLLKEMKIPRGILLAFLIGLPWYIAMYAVHGAAFTDAFIGYHNF
TRFAAPEHPGQNSIFFFVPIVLGAMMPWTGALFQAMYRIIRGNGPYHDGLLFCLIWAVFI
FVFFSFSKTQLVTYIAPLFPPLSIILGWYTYALKRIGRLPRIWLVSSYIGGLILLACNAI
PLNENALFFSTPILWASLLLTAALVLPAICMQLKNWRAALICTVLSMFAFMTVAFAGVLP
QAQEYISGKTIAADYVSLETGNTTVYIEKFLCPALAFYGNITGTAWEINEAPDFKKIRTI
PQKAYFIMQRSTYNKLLQTQPDLNYWQIVRTTPGQLILVNTKEPL

Enzyme Prediction     

No EC number prediction in MGYG000001762_00930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	423	4.3e-108	0.8018518518518518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.44e-58	17	405	13	422	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.75e-35	14	405	10	419	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.13e-18	67	220	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.71e-11	16	226	2	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	0.004	14	174	18	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO73979.1	2.07e-215	6	520	3	517
CCC72524.1	2.07e-215	6	520	3	517
AVO26796.1	2.94e-215	6	520	3	517
ALG41392.1	4.17e-215	6	520	3	517
AXL21031.1	2.31e-202	6	520	3	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.39e-47	29	510	49	561	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	1.29e-33	11	360	4	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.76e-33	11	357	4	356	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
C5BDQ8	6.28e-33	18	333	8	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4ETL9	1.82e-31	9	524	2	526	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
B4EUL1	3.19e-31	6	334	2	337	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
92	114
121	155
170	192
208	230
254	276
289	306
311	333
340	362
367	389
396	418