CAZyme Information: MGYG000001748_00551

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_00551
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1324		146501.51	5.693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 93836; End: 97810 Strand: +

Full Sequence      

MAAVMAMGICSHAALAKEQPGERDESGLIAWYQFAEDGKDSSGHGNDALIGEGVTVSQGV
ASLPGGKSGESAYITLPKGMFDGRDELTITMWLKDEDPRDNWLGAFFFGSPVNENQVPVN
YFYFVPCEKQHETLKAVITDSVNAVQPYSTEKGIRESVQTKGYVGNWTHYAIVLKPGSLA
CYINGRLAGASEVSRTVSDFGSGLEAYIGKSNYTADPLYQGKFKDFRVYGRELGKSEITE
VMSQGHSEDIGQYSMDIDGEKVTKELSADLYGLFYEDINSAADGGLYPEMVKNYSFENAY
VQRGSDAGYFAQYGYETIGNYKLHWDVSPPSAFEVKAEAGINAKNPHYAVITGNAVLKNG
GFAPQSEPNGAAMPVKPDSSYTFSAFARADSGYEGVLKVKAVDSKGNTITEEKTLSVEAD
GTWKKVSVDLASTVKENTKGKIVLSVEGAKKEDSLCLDMISLVPHDSYGYGNMNYACGVG
VRKDLLERMIALNPKFMRFPGGCIVEGFNWEGLYDWRDTIGALEERKSNTNRWENWNNQN
RTWGYMQSYGFGYHELLCLCEDFGMEPFPILSAGVLCQYETADVAAKTGEELNYFIRMAT
DLLDYCWGDPKENEWAEKRAKNGHEQPFDLKYLGIGNENFQAKYFDNLDIIKQAVEDYAK
TNYPQRNLTIISSAGPTSGGENLEYAYDRLAQTMPGETLVDEHYYESESFMYNQSDRYNY
YQRTAQGGSDIFVGEYAVKDDNKFHTALAEAAYITGLERNADVVKHISYAPLLYKTGSLN
WSHDLIYFDEFDTAGSANYYVQQMFGTHYGTKLIDTKLQSEGKDYEHWGSPVIGADKVEG
SIDKITVYGEDGNILFEDDFDDISTEWALFDSALDTKGSASYTIKNGKLNFDSSSGTVLL
YLPRAIKEKWSNYRIVAEGVKKTFGNGGFMVGAGQSDQYYWYHLGKDGNSGSCMEVTRKN
RGESSLTRMVLGNQYPNQHYQTENETKLKNNDNMSITFVYGVGGKLEGSYTSTKTAAEAT
QKYDFSSDLFQYQTDIYQVVNMDEDNVYIKLVNPDAGIKEIKLTFHNLSLDTDKQAEITM
LTGGLNEANSIGRETVAPEISEKPIENETLIYDIPAYSVNVIQIPLKQKGVKPEPEPEPK
PEPKPEPETEPETNRKPEPDKVWQPVQVKISKSALTMGLKEKLTVKASVLPAKASQKVTW
RSSKPSVASVSAGGKITAKKTGSAVITATAQNGISAKCKIKVKKAPKKLSLNKKAVTLKK
GRKFQIRTKLPKNTASYKITFKSGKKSVAAVTAGGKVVAKKKGTAIITVKTFNGVKAKIK
VRVR

Enzyme Prediction     

No EC number prediction in MGYG000001748_00551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	453	1125	7.5e-76	0.8206349206349206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	2.56e-34	435	1127	10	501	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
smart00813	Alpha-L-AF_C	2.35e-15	734	853	1	115	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06964	Alpha-L-AF_C	8.48e-15	734	842	1	120	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam13385	Laminin_G_3	3.38e-11	69	238	2	150	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam02368	Big_2	3.59e-10	1164	1237	1	73	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB43005.1	1.54e-145	28	1127	8	1245
AOK90813.1	1.64e-145	28	1127	8	1245
AIY09633.1	4.12e-145	28	1127	8	1245
QYK65113.1	6.14e-144	28	1127	9	1246
QDA26719.1	7.85e-144	28	1127	8	1245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	2.33e-50	270	828	17	537	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2VRQ_A	7.23e-16	480	705	51	242	StructureOf An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]
6ZTA_A	1.27e-15	480	705	51	242	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZTA_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZTA_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
6ZT6_A	1.27e-15	480	705	51	242	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT6_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT7_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]
6ZT8_A	2.22e-15	480	705	51	242	ChainA, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT8_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_A Chain A, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_B Chain B, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus],6ZT9_C Chain C, Alpha-L-arabinofuranosidase [Thermobacillus xylanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	2.68e-95	246	955	28	679	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	9.64e-53	270	855	59	600	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.36e-50	233	825	20	572	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
Q0CTV2	8.36e-41	270	820	42	538	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
Q2U790	2.79e-39	254	820	27	539	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006979	0.953360	0.038104	0.000902	0.000358	0.000277

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_00551.