CAZyme Information: MGYG000001743_01099

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-884
• CAZyme ID: MGYG000001743_01099
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268		32095.46	8.3397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001743	1187428	MAG	Sweden	Europe

• Gene Location: Start: 1101; End: 1907 Strand: -

Full Sequence      

MNIMYCGDKNTIDGLIISLLSITKHVQDELNIYILTMEFKEHKPLGENERIILEKIVKNK
NKKSFVKIIDASKEYKSCEPVANIDTRFTPYCMLRLYADMFDLPNKILYLDYDVVCNKNF
KEFYDIDNTENEIVGVLDYYGSHFFKKKIYEKDYLNSGVLLLNMELIKKTNLFFEAREMC
KNIKMLMPDQTALNRLCKTKKIVESKYNEQHKMHDDTVFRHFTTTFKFFPRFKTQTIKPW
HIDKLHNILKTYCFDDILDEYKKIKENL

Enzyme Prediction     

No EC number prediction in MGYG000001743_01099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	242	1.3e-31	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	3.76e-35	1	242	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.21e-20	2	241	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	1.72e-17	1	248	3	252	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK15171	PRK15171	4.71e-16	1	241	26	271	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVK99252.1	6.28e-87	1	268	1	273
ANK66321.1	2.73e-85	1	264	1	269
ANK63873.1	2.73e-85	1	264	1	269
ANK58884.1	2.73e-85	1	264	1	269
AMV69877.1	1.30e-83	1	268	1	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	1.34e-06	81	194	82	192	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001743_01099.