CAZyme Information: MGYG000001738_01927

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_01927
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43161.16	7.1327

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 43127; End: 44266 Strand: -

Full Sequence      

MKKLVLALLGAAMLIPTAGAADMTKLPPRQETLKTLVKVNDHYLKNHPDPLQGIPYYSRK
KVYEANIWTRAVYFEGLMALHSIYPDNRYYDYAHDWADGFKWGMRRDDTTTRNADNYCCA
QTYIDLYRLTPEPHMLTKTKGTMNMLINTPQNDDWTWIDAIQMGMPILAKLGHDTGDRRY
YDKAYHMYKWTRDTLAGGLYNQKEGLWWRDKDFVPPYKTPNGKQCYWSRGNGWVVAALVK
VLEETPADDPYRPFYEADLKAMLEAAAKCQRPDGFWNVSLADPDDFGGKELTGTALFVYG
MAYGVRTGLLDSKKFMPVLAKGWNAMVNDAVHPNGYLGYVQGTGKEPKDGQPVAYDSKPD
FDDYGTGCFLLAGSEVYKL

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	63	378	2.1e-89	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.33e-91	37	379	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.25e-42	68	379	36	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72533.1	2.38e-238	1	379	1	376
QCD42095.1	6.27e-236	1	379	1	376
ADY37535.1	1.03e-182	12	379	6	371
QGT72529.1	4.03e-173	26	379	23	372
QUT27387.1	7.09e-173	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.55e-71	1	375	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.44e-62	30	375	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.72e-44	68	379	53	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3K11_A	8.60e-16	148	379	192	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	6.85e-47	68	379	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.10e-43	68	379	60	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.51e-39	20	376	41	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998913	0.000198	0.000188	0.000180	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_01927.