CAZyme Information: MGYG000001738_01809

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_01809
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774		85486.59	6.232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 9529; End: 11853 Strand: +

Full Sequence      

MKTLHLILIAGALLWSAAAQGARVESYPVSAVRLTPSPFDDARRMDIRYLLALDPDRLLA
PYLREAGLTPKAPTYTNWEDTGLDGHIGGHYLSALSYMYAATGDDEIKHRLDYMLAELRR
CQDAAGDGYLCGAPGGRRIWDEVTRGDIRAGAFSLNGGWVPLYNIHKIFAGLRDAWLQTG
SEDARTMLIDLTDWMERTVSGLTDRQIQQMLASEHGGLNEVFADVAAITGDDRYLTLARR
FSHRTLLDPLLRGEDKLTGMHANTQIPKVIGFKRIADLTGDKAWDGAARLFWTNVTGHRS
VSIGGNSVREHFHPADDFSSMMSSEQGPETCNTYNMLRLSKMLYESSADTRYIDYYERAL
YNHILSTIDPVQGGFVYFTPMRPGHYRVYSQPQTSMWCCVGSGLENHARYGETIYAHASD
TIFVNLFIPSILTSDNAGLELSTDFPRSGEVIVKVNPRDEGREFALALRIPSWTTSATLA
VNGTPQPITPTGGYATVRRTWHRGDSVTLTLPMHLKAEPLPDGSNYVSFLCGPVVLAAAT
GNERQDGLFADDSRGGHIADGPRIPLHRLPAIISDDGDLLSHLNPVAGEPLRFTLSGLTD
TRFEGLTLRPFATIRESRYMVYFPHYTQASWQATRDSIAAAEEALMRLDAITADIVTCGE
QQPESDHFITMQDSRIGSDDGLRWRETSGTVTYRMNPASRPVTAVRVTYRPAPRRSARIL
IDGTPIGTLPAGTGTLTHIDLPLPAAINTPLTLTITPADTPTTPHIYTLRLLTE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	32	537	3.5e-208	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	31	537	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.55e-134	32	542	12	506	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.37e-31	541	623	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
COG1331	YyaL	0.005	92	252	279	453	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII66677.1	0.0	23	774	27	783
QJR53846.1	0.0	23	774	27	783
ALA72476.1	0.0	23	774	27	783
QJR61354.1	0.0	23	774	27	783
QJR78256.1	0.0	23	774	27	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.26e-268	23	722	24	746	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.91e-257	23	722	24	746	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	7.38e-26	91	535	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.55e-23	91	535	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	5.92e-18	92	611	76	608	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000914	0.996770	0.001615	0.000261	0.000212	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_01809.