CAZyme Information: MGYG000001714_01127

Basic Information

• Species: Coprococcus_A catus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus_A; Coprococcus_A catus
• CAZyme ID: MGYG000001714_01127
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000001714_1|CGC11	76413.04	5.7534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001714	3463460	Isolate	not provided	not provided

• Gene Location: Start: 1236907; End: 1238901 Strand: +

Full Sequence      

MALEHRISELDTYLFAKGTHYEIYEKMGAHLAEEDGKAGTYFSVWAPNARSVSVVGDFNN
WDRSAHPMQPVQQSGIWDIFVPGVKAGDLYKFAVETSQGYTVLKADPYGNQSQLRPDNAS
VVADIRHFDWTDQAWRKAHQEKKTESPMAIYEVHPGSWKKDPSMPGEFYNFKKLAVELAD
YVLEMGYTHVELIGLSEHPFDGSWGYQVSGYYAPTARYGTPADFMYFVNYMHDHGIGVIL
DWVPAHFPKDEFGLGRFDGTALYEHQDPRKGEHPEWGTYCFNYGRTEVSNFLVANALFWI
EKFHVDGLRVDAVASMLYLDFGRSSGNWIPNEDGGNQNYEAITFLKHLNSIVAQRNPGAM
MIAEESTAWPKVTGDVDDGGLGFTYKWNMGWMHDFLEYMKCDPIFRKYHQNQITFSFMYA
YSENYVLVLSHDEVVHLKKSMIYKMPGTMPEKFGNLRAAYGLMMMHPGKKLLFMGQDFAQ
TAEWNEAKSLDWHLLEKYPEHQQLNHYYCDLLHFYQNEPALYELDDSPEGFAWINGSDAE
HNMLTFCRMTKDKKNCLLCHFNFSPVAYENFQSGVLCPGTYTEVFNSNAAEYGGTGLVNS
EPIEAVKESWDFKDYSIKYHLGAYGVCIFKFDYVEPKPEEPQKPARRYTKEDIHKLAGHY
KKIK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	180	480	2.2e-155	0.9966777408637874
CBM48	26	111	3.9e-21	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	8	631	8	627	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	2	630	1	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	7	630	603	1221	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	27	642	27	638	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	7	632	100	724	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK80008.1	0.0	1	664	1	664
SOB71147.1	3.48e-288	7	631	7	634
BBF44560.1	8.58e-286	2	640	103	745
QYX26973.1	5.44e-283	5	631	9	636
QUF79946.1	7.18e-283	7	631	7	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GR5_A	8.17e-238	7	632	129	774	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	6.59e-237	7	632	129	774	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQZ_A	6.59e-237	7	632	129	774	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	9.34e-237	7	632	129	774	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	2.65e-236	7	632	129	774	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30539	7.59e-258	7	637	7	638	1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
Q8DLB8	7.05e-245	6	632	105	751	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
Q7NL20	1.30e-239	7	630	103	727	1,4-alpha-glucan branching enzyme GlgB OS=Gloeobacter violaceus (strain ATCC 29082 / PCC 7421) OX=251221 GN=glgB PE=3 SV=1
Q2JK68	5.06e-239	7	642	117	762	1,4-alpha-glucan branching enzyme GlgB OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) OX=321332 GN=glgB PE=3 SV=1
Q1AZ86	7.22e-239	7	638	99	721	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001714_01127.