CAZyme Information: MGYG000001699_02166

Basic Information

• Species: Clostridium_J ihumii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J ihumii
• CAZyme ID: MGYG000001699_02166
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1146		136301.65	6.6822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001699	4433668	Isolate	France	Europe

• Gene Location: Start: 5977; End: 9417 Strand: +

Full Sequence      

MSTDKLNKYEYNHLKVYEEKVKRNIQILMEEGMLNDANQMLKEYSEIVKDDIEIYSIEGN
IEILNGNLENAEKIFKSGLEKEKCNFDLSYNLAYLYELKEKYISAYRYYRKALKYASDTN
IDLISIKIDEMHKLNDIREYNSRKKVLIIAHIFPPLGGSGVQRTLKFVKYLRLYGWEPII
VTVGNTINNIKDKTLILEIPKDIEIIRIDEKELMDINDIKEVLELQKNIVNDDKIFQEYL
RKISNSKKNINEVIFAPDYYILWANEVIKKINDEIDISEINNIYTTSGPYSDHIIGYYLK
QKHNKKWVCDFRDEWINNPMANYDINTIEFKIECAMEKSIIKYADKIITTTELARENFIN
SYNIDEKKITMITNGFDEEDFETINIHANNENEKFTIIHNGMLYGNRTPISFINALRNLI
ESKKIDRNKIISYFTLTDNDDKYRDYVKSIGLSNNVKFIGQLNHIESLDKASYADLLLLI
IGKEQKWKSVYSGKIFEYLKFNKPILALSPSKSIVEKMLVSTKMGENFEFEDEKGIEKYI
LKLYKRWQNKCNEQIKIDNLSSFERKTLTMNLSYILNQLTVKEKFENRIKQLIKNSKIIE
AKKIFEEYIEKFGESIESYSIRGILLVVDENLNEAEICFKQGIDIYGSNFNLNYKLAHIY
IIRSNMCKLIGAYKEPYNIFTNEEFEIYKKHIKIQIGKLVDNGELNNAIQIIEQYEKIVQ
KDIEIYSMRANILIRQGDLESSKKILKKGLSIKNDDFDLLYKLAYIYDIDGNKEEARIIY
ELLSILQYDSRLSKIIKYRDFKKSDKYKVILYGNDEKCKQIRNMMKNWKVIKISNQTNYI
DIFKEYECDFIFVVESVDKNKLLDKNIYARKIYFIDDFKTSIIEGLDYKLLNLFNKSKIQ
GIITGLSYAEVGIKEELLPYNFVNLALSSQDIYYDLLLIKNLYKFDEVKNNLKYVIINLA
YYTFDYDMSMSVGKYRIHRYCKYFKSSVHHNKDKIGLDITRDFYENRISFNHYINLIEER
ANTKINIYDENAQYEANRNSRMDYYETRCENTIILEDYLSFLENNNIKPIIVICPTSSYY
KKYFNDNKKKKIFYEIMNEINLKYDFEIIDFFDNELFSDEDFWDYSHLNGKGARKFTNMI
REKIEW

Enzyme Prediction     

No EC number prediction in MGYG000001699_02166.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	2.48e-29	145	545	1	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
sd00006	TPR	6.14e-08	26	114	9	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.90e-07	699	781	11	93	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0438	RfaB	2.48e-07	216	545	21	341	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	5.04e-06	52	118	1	67	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOT70024.1	1.92e-142	17	724	786	1476
QHA65011.1	1.03e-140	144	695	2	562
ANR57241.1	1.03e-140	144	695	2	562
QKU27395.1	1.03e-140	144	695	2	562
BBK94534.1	1.03e-140	144	695	2	562

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001699_02166.