CAZyme Information: MGYG000001692_03589

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_03589
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000001692_33|CGC2	17072.56	7.0044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 42475; End: 42951 Strand: -

Full Sequence      

MNNKISIFSCRPAVMAALLLGGCALKPPMDEVMNSMVSQSQSESASSLLLTYNGFCVGVA
GQQAVTQVCGGKDTRSFEWALGELKMQETCLQARSGNELILAPCDGHAQWVWREDKLFNN
KASRCLDVAGRRHTPNTPLRLAECYGGANQSFLVGGIE

Enzyme Prediction     

No EC number prediction in MGYG000001692_03589.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	5.11e-09	53	150	126	236	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
pfam00652	Ricin_B_lectin	7.80e-07	53	152	10	126	Ricin-type beta-trefoil lectin domain.
cd00161	RICIN	4.25e-06	53	153	9	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
NF035929	lectin_1	7.02e-04	54	152	721	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR58049.1	1.94e-104	15	158	1	144
QSR45663.1	1.94e-104	15	158	1	144
ASX09959.1	1.94e-104	15	158	1	144
AHV37272.1	1.94e-104	15	158	1	144
QKG01674.1	1.59e-103	15	158	1	144

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000009	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_03589.