CAZyme Information: MGYG000001692_00443

Basic Information

• Species: Aeromonas dhakensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas dhakensis
• CAZyme ID: MGYG000001692_00443
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
949		99768.57	9.9027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001692	4914725	Isolate	not provided	not provided

• Gene Location: Start: 90548; End: 93397 Strand: +

Full Sequence      

MSIKIPISAEFDGEGVKKQIAQINAAIKSMGEAIAKANGQKFEPIKLNGKDDLKYFVQQS
EKLLKIQGELNNRMKRSGQDGKNPFLANWSHLYVNEATRLKKQQEALVFLGASFEGPGAP
RRPSTPPPQRPISHPAPGGSASGGANPWVKQGTRVLQSGLNAAGPVGGVVSNALGTGVSA
GFGAGLAGLAGGMAALGVGKLIGAVADKVSDAQVEAIMNDALMRRLGGGVGYLPLREGLR
GASSALDISYNEGQQLASLLARTGNMGGDRASELPAELLNAGGFSRGFGVDPAAGVGVFG
QLRGLGLTRSTEDSRKVGLIIGETIAKSDAFARVDDVMEAIGNYATTQTRQSLGVLNMGG
YAGQLSAMAGSGIPGLDVTGSASLLARVNATLAAGGAKGEASQFLTSTVGSRLGLDPIQT
RILSEGGAWATNDSMFGKGSMAARYGISGPGGGKTLLQETLATLREKYRDPGMLAMATAN
HLGLNMNQSMALLSIKPNEMGGIQSRVGRLGVDMSTIDATGIADLGRIETADSTGLKRIA
NQYLGRTGKGALTADEARDLKAAMDGGDQQKIKDELSKLAATKGVIETEGSKTRDTIAGV
GNIMQKFASESLPILNESRAALLFLAGKGGAKGPRDLLERAMQARHDENVDGISQKYRAQ
INEQVERANRARVGTMGVPVGDEINLPREQQGRAVLERQARAKAEMDAASTEISRLEAER
AKELAAEDARLKAEREQEQKRQEAVRDYTPGRAPVGDHAVIEQIESGGRDYDRAGNVLTS
SAGARGRMQVLDSTNADPGYGVLPARDGSMEERARVGRDYFDALVREFGGDRVAAAAAYN
AGPGRVRGLMSKHGANWLRYAPAETQNYVRQFNGLTSGGTELPREPTRAPTQLPADEQAR
RQSSAAPMQHGPLSGELNVNLSMNGDLRRILNPPAPLVTKVASNWYRSS

Enzyme Prediction     

No EC number prediction in MGYG000001692_00443.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.23e-13	758	871	5	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PHA00658	PHA00658	2.59e-12	765	921	311	473	putative lysin
cd13401	Slt70-like	3.44e-09	780	870	40	140	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.00e-08	759	870	24	138	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	3.56e-06	764	872	16	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNJ57328.1	1.21e-183	1	885	1	910
BCP56319.1	8.86e-179	1	883	1	907
ATI15626.1	1.06e-133	1	732	1	749
BBS25095.1	2.30e-103	1	846	1	855
QJB54613.1	1.68e-80	184	846	1	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001692_00443.