CAZyme Information: MGYG000001691_02159

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02159
• CAZy Family: CBM50
• CAZyme Description: putative L,D-transpeptidase YcfS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000001691_18|CGC3	34393.29	6.2857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 251932; End: 252873 Strand: -

Full Sequence      

MRLPKIMPLSITPTLSLLLVAILLYAAPAEAKRYPLPPVGSRLIGELEDYIIQQNEHLEL
VGKNTQIGFLALLEANPGVDPYLPKPGTRLTLPTQMLLPDVPREGIVINLPELRLYYFPK
GKSEVIVLPIGIGDIGRETPEMTTTVIEKNPDPTWVPGPMVRKSWLEQKGITLPAVVPPG
PENPLGKFAMRLGYGKRDYLIHGTNKDFGVGLRVSAGCIRLRPDDIEALFKMVPVGTQVR
VINQPVKVAIEPDGRRWLEVHSPLSRTEEEMANGAPLILSPMVEQFINAPEVEQAEVTAA
LDSKNGLPRPISG

Enzyme Prediction     

No EC number prediction in MGYG000001691_02159.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10260	PRK10260	1.72e-102	25	308	18	302	L,D-transpeptidase; Provisional
PRK10190	PRK10190	5.48e-98	29	312	19	303	L,D-transpeptidase; Provisional
cd16913	YkuD_like	3.28e-39	106	242	2	121	L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.
COG1376	ErfK	5.46e-39	26	245	18	232	Lipoprotein-anchoring transpeptidase ErfK/SrfK [Cell wall/membrane/envelope biogenesis].
pfam17969	Ldt_C	1.53e-20	245	308	1	64	L,D-transpeptidase C-terminal domain. This is the C-terminal domain found in d-transpeptidases (Ldt) homologues from E.coli. Three of these enzymes (YbiS, ErfK, YcfS) have been shown to cross-link Braun's lipoprotein to the peptidoglycan (PG), while the other two (YnhG, YcbB) form direct meso-diaminopimelate (DAP-DAP, or 3-3) cross-links within the PG. Family members include erfK (ldtA), ybiS (ldtB), ycfS (ldtC), and ynhG (ldtE).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLE84536.1	1.04e-106	31	312	19	299
QXC55304.1	1.47e-88	30	308	19	293
QUY00823.1	1.18e-87	30	308	19	293
QPC55488.1	1.18e-87	30	308	19	293
QTV10206.1	1.18e-87	30	308	19	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LZH_A	6.07e-84	29	308	1	281	ChainA, L,D-transpeptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
6V45_A	4.49e-08	103	242	70	209	Crystalstructure of a Probable carnitine operon oxidoreductase caia from Brucella melitensis [Brucella melitensis bv. 1 str. 16M]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75954	2.06e-95	26	308	23	307	Probable L,D-transpeptidase YcfS OS=Escherichia coli (strain K12) OX=83333 GN=ycfS PE=1 SV=1
P40680	2.83e-90	31	312	21	303	Probable L,D-transpeptidase ErfK/SrfK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=erfK PE=3 SV=1
P39176	2.69e-88	21	312	11	303	Probable L,D-transpeptidase ErfK/SrfK OS=Escherichia coli (strain K12) OX=83333 GN=erfK PE=1 SV=2
P76193	1.63e-87	29	312	21	303	Probable L,D-transpeptidase YnhG OS=Escherichia coli (strain K12) OX=83333 GN=ynhG PE=1 SV=1
P0AAX8	1.24e-85	21	308	14	302	Probable L,D-transpeptidase YbiS OS=Escherichia coli (strain K12) OX=83333 GN=ybiS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999110	0.000151	0.000173	0.000150	0.000139

TMHMM  Annotations     

start	end
7	29