CAZyme Information: MGYG000001691_02144

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_02144
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	MGYG000001691_18|CGC2	26701.77	9.351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 237001; End: 237750 Strand: -

Full Sequence      

MKAWMLAGQMVLIPLSGWSQTPPPAEVVFLTVAPSPLRSIGHAAPAPQPETAQTAATAAG
GKKQIQVYKSVQQNGVVRYSDMAPEQGHYELLLFNDCFACDPKSSVNWQTTGLFLYDYAS
TIKAAAKTYQVEPALIRALIHAESAFNPLAVSRKGAMGLTQLMPATARELGVGNALLAEQ
NIFGGVKYLAGLLKQYDGNIALATAAYNAGAGAVQKHGGIPPYAETRAYVERVQLLHQRY
KEMLQAKGL

Enzyme Prediction     

No EC number prediction in MGYG000001691_02144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	129	235	3.5e-27	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	5.33e-45	133	233	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.95e-42	113	233	1	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.49e-39	116	233	2	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.98e-32	122	229	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	7.82e-30	122	241	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT79705.1	1.08e-167	1	249	1	249
BBU05591.1	2.45e-164	1	249	1	249
BBT94649.1	4.94e-164	1	249	1	249
QPR56825.1	6.06e-164	5	249	1	245
BBR40414.1	2.47e-163	1	249	1	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.17e-13	114	233	412	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.17e-13	114	233	416	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.18e-13	114	233	422	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.18e-13	114	233	426	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.19e-13	114	233	432	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	7.93e-36	103	233	47	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.16e-32	110	233	1414	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.16e-32	110	233	1414	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.18e-14	121	233	10	115	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q30PQ0	6.99e-11	74	214	252	395	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.080260	0.866587	0.052256	0.000335	0.000270	0.000277

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_02144.