CAZyme Information: MGYG000001691_00840

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_00840
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	MGYG000001691_8|CGC2	18968.73	5.2502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 85846; End: 86361 Strand: -

Full Sequence      

MNNKISLACSPALLVALLLGGCTIKPPSTDEMMDSIASIPSEDRVLSPLLTSGDFCVAVS
RQKVLAQPCSGKDDQLFEWDLGELRLQDLCLQAKSDSEVMLAPCDGQAQWEWQKDRLFNS
KVSRCLDVAGRRHTPGTPLRLAECYGGANQSFSWQRPNPWLETLKKQSLTW

Enzyme Prediction     

No EC number prediction in MGYG000001691_00840.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF035930	lectin_2	2.99e-13	69	150	147	236	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
cd00161	RICIN	7.64e-10	67	154	27	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
smart00458	RICIN	1.91e-09	62	155	17	118	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
pfam00652	Ricin_B_lectin	4.42e-07	68	152	30	126	Ricin-type beta-trefoil lectin domain.
NF035930	lectin_2	2.60e-05	103	156	110	159	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYK16513.1	3.90e-120	1	171	1	171
BBU02689.1	8.15e-113	1	171	1	170
QSR45886.1	8.15e-113	1	171	1	170
QPR53874.1	8.15e-113	1	171	1	170
BBR37503.1	2.34e-112	1	171	1	170

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000093	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_00840.