CAZyme Information: MGYG000001691_00509

Basic Information

• Species: Aeromonas veronii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii_A
• CAZyme ID: MGYG000001691_00509
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000001691_5|CGC4	53346.95	10.01

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001691	4542842	Isolate	not provided	not provided

• Gene Location: Start: 142471; End: 143892 Strand: -

Full Sequence      

MRRWIWALLALCCFPLLAAELKPQRLPQPGDLESILQKRELRALVVYERGFYFLDRGAQY
GILVNQLQGFERWLNKTYLAKEKVKLKVVYIPVRQDKLLDYLTEGRGDLVAATMTVTPTR
REQVAFSRPLISSIEEWVVSQQSLPAFSRITQLSGRRVWVRASSSYYESLRQLNWLFREL
GLPPVYIETVPEYLQDGDLLEMVAAGIIPLTVTDSYKGRIWLGGMISGLKAHKLIPLRSN
GTSAWALRKNSPELLKAVNGYLASVSRNSLYSDMTLRRLLVRSDQMSNILAPDPMGRLAT
IRKVLEKYANQYDLDWLMLAALGYKESGLNPKARSPKGAVGLMQLLPSTGREVGINGARL
TTLEGNVEAACRYMRLILDTYFNDPKLDRLNRHLFALAAYNAGPNRVQALRGKAEKLGLD
PNVWFGNVDQLVANEVGQGPINYVGTIYKYYVAYRFSLPQLEGKAAAIEAAQP

Enzyme Prediction     

No EC number prediction in MGYG000001691_00509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	315	453	1.3e-23	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01009	PBP2_YfhD_N	3.85e-63	39	271	1	214	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
cd13403	MLTF-like	9.87e-62	306	455	2	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	1.97e-54	23	456	7	420	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.09e-49	1	473	5	469	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	4.64e-24	302	455	7	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXV20962.1	0.0	1	473	1	473
QHC06544.1	0.0	1	473	1	473
QMS76246.1	0.0	1	473	1	473
AEB51735.1	0.0	1	473	1	473
QET80713.1	0.0	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	2.36e-24	29	425	8	386	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA3_A	5.27e-24	29	467	42	476	Crystalstructure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_B Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_C Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_D Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_E Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_F Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_G Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_H Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_I Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_J Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_K Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA3_L Crystal structure of MltF from Pseudomonas aeruginosa in the presence of tetrasaccharide and tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
4OZ9_A	5.47e-24	29	425	1	379	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	5.85e-24	29	425	8	386	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA1_A	1.73e-23	29	467	42	476	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4XXV1	7.80e-31	27	467	31	467	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=mltF PE=3 SV=1
Q4KHS7	1.93e-30	28	467	30	465	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
A4VP14	1.69e-29	28	467	30	465	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A8ZWR8	3.56e-28	31	424	30	405	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q88P17	6.69e-28	28	466	30	464	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000225	0.999202	0.000168	0.000134	0.000127	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001691_00509.