CAZyme Information: MGYG000001689_02096

Basic Information

• Species: Blautia coccoides
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia coccoides
• CAZyme ID: MGYG000001689_02096
• CAZy Family: GH4
• CAZyme Description: Alpha-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		51399.3	5.3763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001689	6086770	Isolate	United States	North America

• Gene Location: Start: 22610; End: 23974 Strand: +

Full Sequence      

MTNIVLLGAGSTSFSIELLKDISTLPSLGGSTLSLVDIDEKRLRMAEALVTRYCRESKMN
LKIRAFKERRDALVGAEYVICAVKIGGYGPLEKEREIAEAHGYYRGIGDRVSCYYGGIGA
YHQINFLEGLARDMHELCPDAWLVQTANPVFEGTNYITRHYNIKAVGVCHGHNAYKEIIE
ELGLERDKVNVEVVGFNHCIFMTGFKYKGEDAYPLLDQWIEEKSEEYWQSERYMDPNRVF
SKDQLSPGAIEAYRLYGVMPIGDAVRSATPWWTHTDFETKCRWYGKNGGFDSEIGWKSYL
DSKTDIQANLNEIVESGKSVMEAYRPSETTEQHIPFIDSLANGVQRTLTLNVPNRGSIDG
IPDDILVEIPVICNSNGIRNVNVGKLPDRVMNGVILPRLARAQSILTAYENRDREMLVLM
LCEDHRTKSYEQAKNLVDELLAQPWNEAANAHYR

Enzyme Prediction     

No EC number prediction in MGYG000001689_02096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	4	181	3e-49	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	2.42e-145	2	444	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	9.55e-96	4	454	6	442	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05197	GH4_glycoside_hydrolases	3.66e-89	4	442	3	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
PRK15076	PRK15076	1.59e-62	1	442	1	421	alpha-galactosidase; Provisional
cd05296	GH4_P_beta_glucosidase	1.80e-44	4	442	3	413	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB56743.1	0.0	1	454	1	454
QMW80483.1	0.0	1	454	1	454
ACI19700.1	7.59e-151	1	454	1	452
ACK41488.1	3.06e-150	1	454	1	452
AIY88307.1	1.23e-116	6	453	8	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OBB_A	4.57e-115	6	453	8	477	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
3U95_A	1.97e-84	4	453	3	467	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]
6KCX_A	6.48e-84	4	454	15	480	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
7BR4_A	3.49e-83	4	454	15	479	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
7BRF_A	1.98e-82	4	454	15	480	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTM_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33830	7.84e-116	6	453	8	477	Alpha-glucosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aglA PE=1 SV=2
O86960	8.04e-110	6	453	8	477	Alpha-glucosidase OS=Thermotoga neapolitana OX=2337 GN=aglA PE=1 SV=2
O34645	7.55e-31	1	390	1	368	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
I3VRU1	4.28e-28	4	441	13	451	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
P06720	2.37e-25	4	442	7	439	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001689_02096.