CAZyme Information: MGYG000001688_04397

Basic Information

• Species: Hungatella_A hathewayi_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella_A; Hungatella_A hathewayi_A
• CAZyme ID: MGYG000001688_04397
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802		89522.03	5.5139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001688	5654180	Isolate	not provided	not provided

• Gene Location: Start: 121088; End: 123496 Strand: -

Full Sequence      

MRGIPFNTGWTWKRLTEDGPGEPVTLPHDAMRGERRTETAAGGTNTGWYEGYDYLYEKEF
VPDDSLAGKKMILELEGVYHNAEVWVGEQKVMFRPYGYTNFYTDLTACLEFGVKNRIRVI
ARNADQPNSRWYSGAGIYRPATLWVGDAAHILLNGVRVRTLSISPAKVEVTVKTSGPGAV
KVEICDGGKAAAAETAESDGTVTMVLEVPDAKLWSVDTPYLYTCHVTFGGDECRESFGIR
SLSWGDKGFCINGERVILQGACIHHDNGLLGAVCDVDAVERKVRLLRETGYNALRSAHNP
CSKALLDACDRQGMLVMDEYIDHWYIHKTEYDYVPYFEEWWRRDLADMVEKDYNHPCVVL
YSTGNEVSETAQARGISLMREMTDYLHGLDDSRPVTCGINIFFNFLSSIGFGVYSDKKAK
KEADRAEKAAKAGKTSKKKAVGSQFFNNLAGLLGDEFMKRGATLHGCDVKTREAFANMDI
AGYNYGIYRYRHDLKKYPDRLILGTETFCNDAYRFRELAKQNPRILGDFVWAGMDYLGEV
MIGSWEYEEYAKRFDGGCGWVSAGSGRIDLTGKPLCEALYTQVALEKERGPFIGVCPVNH
TGERHSPSAWKMSNAVSSWSWRGCEGRTAHVEVYARADYVVLYVNGREVGRKRMKDDCIA
KFSCAYENGVIEAAAFDADGQEIGRTSLKTAEEETVLLAEPEETSVRAGHLCYVRLRYAD
SQGITKPMARGMIKVETDGGELLALGNACPYNERGYLTDETEPYYGEALAIVRAGSGQSI
RLRAVGETENCRTEIVIPVIDE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	553	2.7e-95	0.5771276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.91e-55	47	415	58	447	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.34e-41	53	403	66	452	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.38e-26	55	395	112	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.04e-18	104	366	173	462	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	5.36e-18	246	416	5	183	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30385.1	0.0	1	797	1	796
QHB24152.1	0.0	1	797	1	796
QEI31653.1	0.0	1	797	1	796
QOL32321.1	0.0	1	774	1	785
QOL35067.1	0.0	1	775	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	3.70e-113	1	775	5	753	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.53e-112	1	775	5	753	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	6.08e-82	3	793	27	813	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	9.11e-81	2	774	8	782	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T9A_A	2.05e-77	6	774	32	820	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	3.69e-79	18	796	68	844	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	9.54e-58	6	697	51	714	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.36e-24	4	394	15	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.89e-23	18	415	76	491	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	6.21e-21	61	369	120	444	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001688_04397.