CAZyme Information: MGYG000001682_00843

Basic Information

• Species: Paramuribaculum sp900760855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900760855
• CAZyme ID: MGYG000001682_00843
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		34739.4	7.5622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001682	2633261	MAG	United States	North America

• Gene Location: Start: 47772; End: 48683 Strand: -

Full Sequence      

MAATAIFSVCGNLNATEPAMTDVVAPHIPHHITFAGDRVDMDRVDMYERFDRELTSMTFT
HGTTLLTIKRANKYFPTLVPILKEYGVPTDLIYLACIESNLNPRAVSGAGAAGLWQFMPA
TAREYGLEVNDYVDERYHPEKSTIAAIKYLKNAYNKYGNWESTAASYNAGMGRISRELDA
QQVGSAYDLYLNDQTSRYMFRLLAMKSILEHPGHFGYKLTESQLYFPIEYREIEINGPIE
DWQQWSIDNGTTYQQLRELNPWIRAKSLPNKSNKTYMVRIPAKDAMSRSKQHHKVFNHNW
ISK

Enzyme Prediction     

No EC number prediction in MGYG000001682_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	81	205	4e-24	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	7.26e-67	82	206	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	6.01e-32	85	176	8	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	6.09e-26	33	222	64	257	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	3.89e-21	98	176	11	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.03e-18	74	176	6	113	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB38769.1	1.43e-136	3	301	10	319
QQR09511.1	1.43e-136	3	301	10	319
ANU63153.1	1.43e-136	3	301	10	319
QCD35372.1	2.16e-136	12	301	42	331
QCD43280.1	5.20e-136	1	302	15	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EYB_I	2.31e-08	86	203	24	143	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	2.32e-08	86	203	46	165	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
5OHU_A	1.94e-07	77	249	481	641	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	2.53e-07	77	244	452	607	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	4.51e-07	77	249	453	613	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.95e-23	34	285	62	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.95e-23	34	285	62	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	3.32e-12	61	178	7	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	3.62e-11	84	176	70	158	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.33e-09	54	174	1401	1518	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001682_00843.